KEGG   Streptomyces avermitilis: SAV_5766Help
Entry
SAV_5766          CDS       T00126                                 

Gene name
galM1
Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sma  Streptomyces avermitilis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sma00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sma00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(6970843..6971994)
Genome map
AA seq 383 aa AA seqDB search
MELNRRTLIAGTAAAGIAATTLGGTAQAAPGSGRPVKELFGKLADGTKIYRWSLENGGTR
LKVLSYGGIVQSLEIPDRHGRYKNVSLGFATIEDYVAKTPYFGALIGRYGNRIAKGRFDL
DGKSYQLSVNDGVNSLHGGAKGFDKRPWDIEGFTSGSDVGLHLYYTSVDGEMGYPGTLKA
KVTYTLTRHGDWRIDYEATTDKATVVNLTSHVYWNLAGEGSGSIYDHELKIAAARYTPVD
SGLIPTGELAKVAGTPFDFRRTKTVGEDIREANQQLLYGKGIDHNWVLDKGITAKPAHVA
TLRDPSSGRTLRIATTEPGLQFYSGNFLDGTLVGPGGHIYRQGDALCLETQHFPNSPNQP
AFPSTVLRPGETYRSSTVHSFDA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggaactgaacagacgcacactcatcgcgggcaccgcggccgcgggcatcgcggcgacc
acgctcggcgggacggcacaggccgccccgggaagcggaaggccggtgaaggagctcttc
ggcaagctcgccgacgggacgaagatctaccgctggtcgctggagaacggcggcacccgg
ctgaaggtcctgtcgtacggcggcatcgtccagtccctggagatcccggaccggcacggc
cgctacaagaacgtgtcgctgggcttcgccaccatcgaggactacgtcgcgaagaccccg
tacttcggcgcgctcatcggccggtacggaaaccgtatagccaagggccggttcgacctc
gacggcaagtcctaccagctgtccgtcaacgacggggtcaacagcctgcacggcggcgcc
aagggcttcgacaagcgcccctgggacatcgagggcttcacctccggttcggacgtgggc
ctgcacctgtactacacgagcgtcgacggcgagatgggctacccgggcacgctcaaggcg
aaggtcacctacacgctgaccaggcacggcgactggcgcatcgactacgaggccaccacc
gacaaggccaccgtcgtcaacctcaccagccatgtctactggaacctggcgggcgagggc
agcggctcgatctacgaccacgaactgaagatcgccgccgcccgctacacccccgtcgac
tcgggcctgatccccaccggtgagctggccaaggtcgcgggcacccccttcgacttccgc
cgtacgaagaccgtcggcgaggacatccgagaggcgaaccagcagctcctgtacggcaag
ggcatcgaccacaactgggtcctcgacaaggggatcacggcgaagcccgcgcacgtcgcg
acgctccgggacccgtcctcgggccgcacgctgaggatcgcgacgaccgagccgggcctt
cagttctactccggcaacttcctggacggcacactggtcggccccggcgggcacatctac
cgccagggcgacgcgctgtgcctggagacccagcacttccccaactcgccgaaccagccg
gcgttcccgtcgacggtgctgcggccgggcgagacctaccgcagctcgacggtgcactcg
ttcgacgcctga

DBGET integrated database retrieval system