KEGG   Streptomyces avermitilis: SAV_5766Help
Entry
SAV_5766          CDS       T00126                                 

Gene name
galM1
Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sma  Streptomyces avermitilis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAV_5766 (galM1)
   00052 Galactose metabolism
    SAV_5766 (galM1)
Enzymes [BR:sma01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SAV_5766 (galM1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(6970843..6971994)
Genome map
AA seq 383 aa AA seqDB search
MELNRRTLIAGTAAAGIAATTLGGTAQAAPGSGRPVKELFGKLADGTKIYRWSLENGGTR
LKVLSYGGIVQSLEIPDRHGRYKNVSLGFATIEDYVAKTPYFGALIGRYGNRIAKGRFDL
DGKSYQLSVNDGVNSLHGGAKGFDKRPWDIEGFTSGSDVGLHLYYTSVDGEMGYPGTLKA
KVTYTLTRHGDWRIDYEATTDKATVVNLTSHVYWNLAGEGSGSIYDHELKIAAARYTPVD
SGLIPTGELAKVAGTPFDFRRTKTVGEDIREANQQLLYGKGIDHNWVLDKGITAKPAHVA
TLRDPSSGRTLRIATTEPGLQFYSGNFLDGTLVGPGGHIYRQGDALCLETQHFPNSPNQP
AFPSTVLRPGETYRSSTVHSFDA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggaactgaacagacgcacactcatcgcgggcaccgcggccgcgggcatcgcggcgacc
acgctcggcgggacggcacaggccgccccgggaagcggaaggccggtgaaggagctcttc
ggcaagctcgccgacgggacgaagatctaccgctggtcgctggagaacggcggcacccgg
ctgaaggtcctgtcgtacggcggcatcgtccagtccctggagatcccggaccggcacggc
cgctacaagaacgtgtcgctgggcttcgccaccatcgaggactacgtcgcgaagaccccg
tacttcggcgcgctcatcggccggtacggaaaccgtatagccaagggccggttcgacctc
gacggcaagtcctaccagctgtccgtcaacgacggggtcaacagcctgcacggcggcgcc
aagggcttcgacaagcgcccctgggacatcgagggcttcacctccggttcggacgtgggc
ctgcacctgtactacacgagcgtcgacggcgagatgggctacccgggcacgctcaaggcg
aaggtcacctacacgctgaccaggcacggcgactggcgcatcgactacgaggccaccacc
gacaaggccaccgtcgtcaacctcaccagccatgtctactggaacctggcgggcgagggc
agcggctcgatctacgaccacgaactgaagatcgccgccgcccgctacacccccgtcgac
tcgggcctgatccccaccggtgagctggccaaggtcgcgggcacccccttcgacttccgc
cgtacgaagaccgtcggcgaggacatccgagaggcgaaccagcagctcctgtacggcaag
ggcatcgaccacaactgggtcctcgacaaggggatcacggcgaagcccgcgcacgtcgcg
acgctccgggacccgtcctcgggccgcacgctgaggatcgcgacgaccgagccgggcctt
cagttctactccggcaacttcctggacggcacactggtcggccccggcgggcacatctac
cgccagggcgacgcgctgtgcctggagacccagcacttccccaactcgccgaaccagccg
gcgttcccgtcgacggtgctgcggccgggcgagacctaccgcagctcgacggtgcactcg
ttcgacgcctga

DBGET integrated database retrieval system