KEGG   Streptomyces avermitilis: SAV_5915Help
Entry
SAV_5915          CDS       T00126                                 

Gene name
phoA
Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
sma  Streptomyces avermitilis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SAV_5915 (phoA)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SAV_5915 (phoA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SAV_5915 (phoA)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SAV_5915 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
7126402..7128048
Genome map
AA seq 548 aa AA seqDB search
MTPAGHQHPSQHAPELRAAARHLGRRRFLTVTGAAAALAFAVNLPGAGVAGAAEFDAAKL
TDDPFTLGVASGDPLPDSVLLWTRLAPAPYQADGGLPPERVAVRWELAHDARFRRIVRRG
TATAHPEFDHAVHVEVGHLDPDRVLYYRFRAGGWVSETGRTRTAPATRDRVAGLRFAAVS
CQAYHDGYFTPYGHLAEDDVDVVFHLGDYLYEYAVNSAGGARKYTDRVLPDLFNHETTTL
EDYRLRYALYKSDPDLRAAHAAHPFVVTWDDHETENNYAGDIDENEDPPEEFLLRRAAAY
RAYWENQPLRRPQLPDGPDARMYRRLGWGRLAQFDILDTRQYRSNQAYGDGAHVPGPESD
DPARTITGATQERWLIDGWRDSRALWNVVPQQVTFSQRKLDLNAAAKVSMDAWDGYRASR
ERVLAGAQSAGVENLMVLTGDVHVGYAFDIKDDFDDPSSATLGTEIVATSVSSGKDGAEK
PANWNTYMTANPHLKFYNGRRGYVTVELGREAARADFKTVSAVTTQGAPLTTAASFVTEV
GEQGLKPV
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgacacccgcaggccaccagcatccgtctcagcacgcccccgaactccgcgccgccgcc
cgtcacctcgggcgccgccgtttcctcaccgtcaccggcgcggccgccgcgctcgccttc
gccgtcaacctgcccggcgcgggcgtggccggcgccgccgagttcgacgcggcgaagctc
accgacgacccgttcaccctcggcgtggcctccggcgacccgctgcccgactcggtactc
ctgtggacgcggctcgccccggcgccctaccaggccgacggcggcctgcccccggaacgc
gtcgccgtgcgctgggaactggcccacgacgccaggttccgccggatcgtcagacgcggg
accgcgacggcacaccccgagttcgaccacgccgtccacgtggaggtcggccacctcgac
cccgaccgggtcctctactaccgcttccgggccggcggctgggtcagtgagaccggccgc
acccgcaccgcgcccgccacccgcgaccgggtcgccggcctcaggttcgccgccgtctcc
tgccaggcctaccacgacggctacttcaccccgtacgggcatctcgccgaggacgacgtc
gacgtcgtcttccacctcggcgactacctgtacgagtacgcggtcaactcggccggcggc
gcccggaagtacaccgaccgcgtcctgcccgacctcttcaaccacgagaccacgacgctg
gaggactaccggctgcggtacgccctctacaagtccgacccggacctgcgggccgcccac
gccgcgcaccccttcgtcgtcacctgggacgaccacgagaccgagaacaactacgccggc
gacatcgacgagaacgaggacccgcccgaggagttcctgctgcgccgtgccgccgcctac
cgcgcgtactgggagaaccagccgctgcgccgcccccagctgccggacggaccggacgcc
cggatgtaccggcgtctgggctggggccgactggcccagttcgacatcctcgacacgcgc
cagtaccgctccaaccaggcgtacggcgacggagcgcacgtccccggcccggagtcggac
gacccggcgcgcaccatcaccggcgcgacgcaggagcgctggctgatcgacggctggcgc
gactcgcgggcgctgtggaacgtcgtaccgcagcaggtcaccttctcgcagcgcaagctg
gacctgaacgccgccgccaaggtgtccatggacgcctgggacggctaccgggcctcgcgc
gaacgggtcctcgccggggcgcagtcggccggcgtcgagaacctgatggtgctcaccggt
gacgtccacgtcgggtacgccttcgacatcaaggacgacttcgacgacccgtcgtcggcg
acgctcggcacggagatcgtggcgacgtcggtctccagcggcaaggacggcgccgagaag
ccggcgaactggaacacgtacatgaccgccaacccgcatctgaagttctacaacgggcgg
cggggttatgtgacggtcgagctgggccgggaggcggcgcgggccgacttcaagacggtg
tccgccgtgacgacgcagggagcgccgctcacgacggccgcgtcgttcgtgaccgaggtg
ggggagcaggggttgaagccggtgtga

DBGET integrated database retrieval system