KEGG   Streptomyces avermitilis: SAV_6022Help
Entry
SAV_6022          CDS       T00126                                 

Gene name
sucB
Definition
dihydrolipoamide S-succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sma  Streptomyces avermitilis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:sma01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sma00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:sma00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(7250648..7252471)
Genome map
AA seq 607 aa AA seqDB search
MPVSVTLPALGESVTEGTVTRWLKAEGERVEADEPLLEVSTDKVDTEIPSPAAGVLASIK
VAEDETVEVGAELAVIDDGTGAPAAAPAPAAEQAAEQVAPPAPEPAPQATPSTEQAAPAP
APTAEAAAGAGSAEGTDVVLPALGESVTEGTVTRWLKEVGEEVSEDEPLLEVSTDKVDTE
IPAPASGTLLLEIVVGEDETAEVGAKLAVIGAPGAAPAAAPAQAAPAPAAAPAAPAPAPA
APAPAAPAPAPAAPAPAQAAPAAPAAPAQAAPAPAAPQAPAAPAPAPVTPAAAPAATSGD
DGAYVTPLVRKLAAENGVDLATVKGTGVGGRIRKQDVTAAAEAAKAAAPAPAAAPAAAKK
APALEVSPLRGQTVKMPRIRKVIGDNMVKALHEQAQLSSVVEVDITRLMKLRAQAKDSFA
AREGVKLSPMPFFVKAAAQALKAHPAVNARINVDEGTITYFDTENIGIAVDSEKGLMTPV
IKHAGDLNIAGIAKATADLAGKVRANKITPDELSGATFTISNTGSRGALFDTIIVPPNQV
AILGIGATVKRPAVIETEEGTVIGVRDMTYLTLSYDHRLVDGADAARYLTAVKAILEAGE
FEVELGL
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgccggtttccgtaacccttccggcgctcggcgagagcgtcaccgagggcactgtcacc
cgctggctgaaggccgagggtgaacgcgtcgaggccgacgagccgctgctcgaggtgtcg
accgacaaggtcgacaccgagatcccctcccccgccgccggcgtgctcgcgtccatcaag
gtcgccgaggacgagacggtcgaggtcggcgccgagctggccgtcatcgacgacggcacg
ggcgcgcccgccgccgccccggccccggccgccgagcaggccgccgagcaggtcgccccg
ccggctcccgagccggcgccgcaggccaccccgtccaccgagcaggccgcccccgcgccg
gccccgaccgccgaggccgccgccggcgccggcagcgccgagggcaccgacgtcgtcctg
cccgcgctgggcgagtcggtcaccgagggcaccgtcacccgctggctgaaggaggtcggc
gaggaggtctcggaggacgagccgctgctcgaggtctccacggacaaggtcgacaccgag
atcccggcgcccgcctccggcacgctgctgctcgagatcgtggtcggcgaggacgagacg
gccgaggtcggcgcgaagctcgccgtcatcggtgcgcccggtgccgctccggcggccgcc
ccggcgcaggccgcgcccgcgcccgccgccgccccggccgccccggctcccgccccggct
gccccggctccggccgctccggctccggctccggccgccccggccccggctcaggccgcc
cccgcggcgcccgccgccccggctcaggccgctccggccccggccgctccgcaggccccg
gccgccccggcgccggcccccgtcaccccggccgcggcgcccgccgcgacctccggtgac
gacggcgcctacgtgaccccgctggtgcgcaagctcgccgccgagaacggcgtcgacctg
gccaccgtcaagggcaccggcgtcggcggccgcatccgcaagcaggacgtcaccgccgcc
gccgaggccgcgaaggccgccgctccggcgcccgccgccgctccggccgccgcgaagaag
gccccggccctggaggtctcccccctccgcggccagaccgtcaagatgccccgcatccgc
aaggtcatcggcgacaacatggtgaaggccctgcacgagcaggcccagctctcctcggtc
gtcgaggtggacatcacccgcctgatgaagctccgcgcgcaggcgaaggactccttcgcg
gcccgcgagggcgtcaagctctccccgatgccgttcttcgtgaaggcggcggcccaggcg
ctgaaggcccacccggccgtcaacgcccggatcaacgtggacgagggcacgatcacctac
ttcgacaccgagaacatcggtatcgcggtggactccgagaagggcctgatgaccccggtc
atcaagcacgcgggcgacctcaacatcgccggtatcgccaaggccaccgccgacctggcg
ggcaaggtccgggcgaacaagatcaccccggacgagctgtccggcgcgaccttcaccatc
tccaacaccggctcgcgcggcgcgctcttcgacacgatcatcgtgccgccgaaccaggtc
gcgatcctcggcatcggtgccacggtcaagcgcccggccgtcatcgagacggaggagggt
acggtcatcggcgtccgcgacatgacgtacctgacgctctcctacgaccaccgtctggtg
gacggcgccgacgcggcccgttacctgaccgcggtcaaggcgatcctggaggcgggcgag
ttcgaggtcgagctcggcctgtaa

DBGET integrated database retrieval system