KEGG   Streptomyces avermitilis: SAV_6079Help
Entry
SAV_6079          CDS       T00126                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
sma  Streptomyces avermitilis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(7315301..7316218)
Genome map
AA seq 305 aa AA seqDB search
MRSRTVKYASKPRGTLVVLFVITPLMNTHLMNRRPKVPVLPGAEPYRHEGGEVGVLLCHG
FTGSPQSLRPWAEYLAERGLTVSLPLLPGHGTRWEDMQLTGWQDWYAELDRELRALRDRC
TQVFVFGLSMGAALAMRLAAKHGDEISGLVLVNPANKVHGPAAYALPVLRHLVPSVKGII
SDIAKEGGVEIGYSRVPLHAAHSMRNLYALVDGELPQVTQPMLLLHSPQDHVVPPADSAR
ILSRVSSTDVTESLLEQSYHVATLDHDADRIFEESYAFLGRLAPAVGKKSGVGHVDQQEG
TATGG
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgcggtcgcgtacggtgaagtacgcctcgaagcctcggggcacgctcgtcgtgcttttc
gtgatcacccccctcatgaacacccacctcatgaacaggagaccgaaggtgccggtcctt
cctggagccgagccgtaccgccacgagggcggggaggtcggcgtcctcctctgccacggc
ttcaccggttccccgcagtcgctgcgcccctgggcggagtatctcgccgagcgcggtctg
accgtgtcgctgcccctgctgcccgggcacggcacgcgctgggaggacatgcagctcacc
ggctggcaggactggtacgcggagctggaccgcgagctgcgcgccctgcgcgaccgctgc
acacaggtgttcgtcttcggtctgtccatgggcgccgcgctggcgatgcggctggccgcg
aagcacggggacgagatcagcggcctcgtgctcgtcaacccggcgaacaaggtgcacggc
ccggccgcgtacgcccttccggtgctgcggcacctcgtcccttccgtgaaggggatcatc
agcgacatcgcgaaggagggcggcgtcgagatcggctactcccgcgtcccgctgcacgcg
gcccactccatgcggaacctctacgcgctggtcgacggcgagctgccccaggtcacccag
ccgatgctgctgctgcacagcccgcaggaccatgtggtgccgccggccgactcggcgcgc
atcctcagccgggtgtcgtccacggacgtgacggagagcctgctggaacagagctaccac
gtggcgacgttggaccacgacgcggaccggatcttcgaggagagctacgccttcctcggc
aggctcgcacccgccgtcggcaagaagtccggggtgggacacgtggaccagcaggaaggg
acggccaccggtggctga

DBGET integrated database retrieval system