KEGG   Streptomyces avermitilis: SAV_6083Help
Entry
SAV_6083          CDS       T00126                                 

Gene name
pfkA2
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sma  Streptomyces avermitilis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:sma01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sma01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sma00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:sma00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sma00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sma00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:sma00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
7319161..7320189
Genome map
AA seq 342 aa AA seqDB search
MRVGVLTGGGDCPGLNAVIRGVVRKGVQEYGYDFVGFRDGWRGPLEGDAVRLDIPAVRGI
LPRGGTILGSSRTNPLKLDDGIRRIKENLAKQEVDALIAIGGEDTLGVAARLTDEYGVPV
VGVPKTIDNDLSATDYTFGFDTAVGIATEAIDRLHTTAESHMRVLVCEVMGRHAGWIAIH
SGLAGGANVILIPEQRFDVDQVCAYVTSRFKASYAPIVVVAEGAMPKDGQMVLKDESLDS
FGHVRLSGVGEWLAKEIEKRTGKEARTTVLGHVQRGGTPSAFDRWLATRFGLHAIEAVRD
GDFGKMVALRGTDIVRVPIAEATAKLKTVDPKLYEEVGVFFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtcggagtactgaccggaggcggcgactgccccgggctcaacgccgtcatccgg
ggcgtcgtccgtaagggcgtgcaggagtacggctacgacttcgtcggcttccgggacggc
tggcggggaccactcgaaggcgacgccgtacggctcgacatccccgcggtgcgcggcatc
ctgccccgcggcggcacgatcctcggctcctcgcgcaccaaccccctcaagctcgacgac
ggcatccgccggatcaaggagaacctcgccaagcaggaggtcgacgcgctcatcgcgatc
ggcggcgaggacacgctcggcgtcgccgcacgcctcaccgacgagtacggcgtgcccgtc
gtcggcgtcccgaagaccatcgacaacgacctgtcggccaccgactacacgttcggcttc
gacacggccgtcggcatcgcgaccgaggccatcgaccgcctccacaccaccgccgagtcc
cacatgcgcgtcctcgtctgcgaggtgatgggccggcacgcgggctggatcgccatccac
tcgggcctggccggcggcgccaacgtcatcctcatccccgagcagcgcttcgacgtcgac
caggtgtgcgcctatgtgacctcgcggttcaaggcctcgtacgcgccgatcgtggtcgtc
gccgagggcgcgatgcccaaggacggccagatggtcctcaaggacgagtccctcgactcc
ttcggccacgtgcgcctctccggggtcggcgagtggctggccaaggagatcgagaagcgc
accggcaaggaggcccgcaccacggtcctcgggcatgtgcagcgcggcggcacgccgagc
gcgttcgaccgctggctcgccacccgcttcggcctgcacgccatcgaggccgtccgcgac
ggcgacttcggcaagatggtcgccctgcgcggcacggacatcgtccgtgtcccgatcgcg
gaggccacggcgaagctgaagacggtcgatccgaagctgtacgaggaggtcggggtcttc
ttcggctga

DBGET integrated database retrieval system