KEGG   Streptomyces avermitilis: SAV_6083Help
Entry
SAV_6083          CDS       T00126                                 

Gene name
pfkA2
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sma  Streptomyces avermitilis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAV_6083 (pfkA2)
   01230 Biosynthesis of amino acids
    SAV_6083 (pfkA2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAV_6083 (pfkA2)
   00030 Pentose phosphate pathway
    SAV_6083 (pfkA2)
   00051 Fructose and mannose metabolism
    SAV_6083 (pfkA2)
   00052 Galactose metabolism
    SAV_6083 (pfkA2)
  Energy metabolism
   00680 Methane metabolism
    SAV_6083 (pfkA2)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SAV_6083 (pfkA2)
Protein phosphatases and associated proteins [BR:sma01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SAV_6083 (pfkA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
7319161..7320189
Genome map
AA seq 342 aa AA seqDB search
MRVGVLTGGGDCPGLNAVIRGVVRKGVQEYGYDFVGFRDGWRGPLEGDAVRLDIPAVRGI
LPRGGTILGSSRTNPLKLDDGIRRIKENLAKQEVDALIAIGGEDTLGVAARLTDEYGVPV
VGVPKTIDNDLSATDYTFGFDTAVGIATEAIDRLHTTAESHMRVLVCEVMGRHAGWIAIH
SGLAGGANVILIPEQRFDVDQVCAYVTSRFKASYAPIVVVAEGAMPKDGQMVLKDESLDS
FGHVRLSGVGEWLAKEIEKRTGKEARTTVLGHVQRGGTPSAFDRWLATRFGLHAIEAVRD
GDFGKMVALRGTDIVRVPIAEATAKLKTVDPKLYEEVGVFFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtcggagtactgaccggaggcggcgactgccccgggctcaacgccgtcatccgg
ggcgtcgtccgtaagggcgtgcaggagtacggctacgacttcgtcggcttccgggacggc
tggcggggaccactcgaaggcgacgccgtacggctcgacatccccgcggtgcgcggcatc
ctgccccgcggcggcacgatcctcggctcctcgcgcaccaaccccctcaagctcgacgac
ggcatccgccggatcaaggagaacctcgccaagcaggaggtcgacgcgctcatcgcgatc
ggcggcgaggacacgctcggcgtcgccgcacgcctcaccgacgagtacggcgtgcccgtc
gtcggcgtcccgaagaccatcgacaacgacctgtcggccaccgactacacgttcggcttc
gacacggccgtcggcatcgcgaccgaggccatcgaccgcctccacaccaccgccgagtcc
cacatgcgcgtcctcgtctgcgaggtgatgggccggcacgcgggctggatcgccatccac
tcgggcctggccggcggcgccaacgtcatcctcatccccgagcagcgcttcgacgtcgac
caggtgtgcgcctatgtgacctcgcggttcaaggcctcgtacgcgccgatcgtggtcgtc
gccgagggcgcgatgcccaaggacggccagatggtcctcaaggacgagtccctcgactcc
ttcggccacgtgcgcctctccggggtcggcgagtggctggccaaggagatcgagaagcgc
accggcaaggaggcccgcaccacggtcctcgggcatgtgcagcgcggcggcacgccgagc
gcgttcgaccgctggctcgccacccgcttcggcctgcacgccatcgaggccgtccgcgac
ggcgacttcggcaagatggtcgccctgcgcggcacggacatcgtccgtgtcccgatcgcg
gaggccacggcgaagctgaagacggtcgatccgaagctgtacgaggaggtcggggtcttc
ttcggctga

DBGET integrated database retrieval system