KEGG   Streptomyces avermitilis: SAV_6117Help
Entry
SAV_6117          CDS       T00126                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
sma  Streptomyces avermitilis
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sma00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sma00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
7356881..7358401
Genome map
AA seq 506 aa AA seqDB search
MTYPGPPRPAHVSATPLAELAGQMGAATPERDAEVTGITHDSRAVRPGDLYAALPGARLH
GADFVTQAAGLGAVAVLTDPTGADRAAATGLPVLVVDDPRGRMGELAATIYGHPGRDLLQ
IGITGTSGKTTTAYLIEGGLRTVRSTGLIGTVEMRIGDERIKSERTTPEATDLQALFAVM
RERGVDAVAMEVSSHALVLGRVDGCVFDIAVFNNLSPEHMEFHSDMEDYFRAKAQLFTPQ
RSKLGVVNFDDEYGRRLVEEAGVPIVTFSAEGHPDADWRAQDVEVGPMDSTFTVIGPKEE
RITARSPLAGPFNVANTLAAIVALAAAGLDPQAAADGIAAVPGVPGRLERVDVGQPYLAV
VDYAHKTDAVESVLRALRKVTEGKLHIVLGCGGDRDRTKRMPMGAAAARLADTAVLTSDN
PRSEDPLAILATMLAGAAEVPSHERGEVQVFENRAAAIAAVVARARPGDTVLVAGKGHEQ
GQDIAGVVRPFDDRLVLREAIQQTQG
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
gtgacatatccagggccgccccgaccggctcatgtctccgccacacccctcgcggaactg
gccggtcagatgggtgccgccacgccggagcgcgacgccgaggtcacggggatcacccac
gactcgcgcgccgtccgccccggcgacctgtacgccgccctgcccggcgcccgcctgcac
ggcgccgacttcgtgacccaggcggccggcctgggcgccgtggccgtgctcaccgacccg
acgggcgccgatcgtgccgccgccaccggtctgcccgtgctggtcgtcgacgacccgcgt
ggccggatgggcgagctggcggccacgatctacggccacccggggcgcgacctgctccag
atcggcatcaccggcacctccggcaagaccacgaccgcctacctcatcgagggcggtctg
aggacggtccgcagcaccgggctgatcggcaccgtcgagatgcgcatcggcgacgagcgc
atcaagtccgagcgcaccacccccgaagccaccgacctccaggccctgttcgcggtcatg
cgtgagcgcggggtcgacgcggtcgccatggaggtctccagccacgcgctggtcctcggc
cgggtcgacggctgcgtcttcgacatcgccgtcttcaacaacctcagcccggaacacatg
gagttccactccgacatggaggactacttccgggccaaggcgcagctgttcaccccgcaa
cgcagcaaactcggtgtggtcaacttcgacgacgagtacggccgcaggctggtcgaggaa
gccggcgtcccgatcgtcaccttctccgccgagggccatcccgacgccgactggcgcgcc
caggacgtcgaagtcggccccatggactcgacgttcaccgtgatcggccccaaggaggag
cggatcacggccaggtcgccgctcgccgggcccttcaacgtggcgaacaccctcgccgcg
atcgtcgccctcgccgcggccgggctcgacccgcaggccgccgccgacggcatcgccgcg
gtgccgggcgtgccgggccgcctggagcgcgtggacgtgggccagccgtacctcgcggtc
gtcgactacgcccacaagaccgacgccgtcgaatcggtgctgcgcgccctgcgcaaggtc
accgagggcaaactgcacatcgtgctcggctgcggcggcgaccgggacagaacgaagcgg
atgccgatgggcgccgccgcggcccggctcgccgacaccgccgtactgacatcggacaac
ccccgctcggaggaccccctcgcgatcctcgccacgatgctggcgggcgccgccgaggtg
ccctcgcacgagcgcggcgaggtccaggtcttcgagaaccgggcggccgccatcgcggcc
gtcgtcgcccgcgcacggccgggcgacaccgtgctggtcgcgggcaaggggcatgagcag
ggccaggacatcgccggtgtggtgcgtcccttcgacgaccgcctggtgctacgcgaagct
atccagcagacccagggatga

DBGET integrated database retrieval system