KEGG   Streptomyces avermitilis: SAV_6139Help
Entry
SAV_6139          CDS       T00126                                 

Gene name
phoD1
Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
sma  Streptomyces avermitilis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SAV_6139 (phoD1)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SAV_6139 (phoD1)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SAV_6139 (phoD1)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SAV_6139 (phoD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(7383111..7384772)
Genome map
AA seq 553 aa AA seqDB search
MTSRHRSSDTAHTFSPRRRTVVKAAAATAVLAGPLAAALPARAATETPAFLHGVASGDPL
PDGILLWTRVTPTAEAIPGSGLGPDTEVSWTVAKDKTFTAIVAKGSTTATAASDHTVKAD
IRGLQPATDYFFRFSAGGTDSPVARTRTAPAADAGVAGLRFGVVSCANWEAGYFSPYRHL
AARGDLDAWLHLGDYIYEYKSGEYAARGKVVRPHAPANEILTLADYRTRHGRYKTDPDLQ
ALHHKAPVVAIWDDHEFADNAWSGGAGNHTEGAEGTWTARQAAAKQAYFEWMPVRPAIEG
TTYRRLRFGKLADLSLLDLRSFRSQQASTGSGTVDDPERTLTGRVQLDWLKAGLKASDTT
WRLVGNSVMISPFAIGELSADLFKPLAKLLGLPQEGIALNTDQWDGYTDDRRELLAHLRN
NAIRNTVFLTGDIHMAWANDVPFDAGTYPLSASAGTEFVVTSVTSDNLDDIVKVPEGTVS
AVAAPLIRAANRHVHWVDTDRHGYGVLDITADRAQMDYYVLSDRTDPNATSSWARSYRTR
SGTQKVERTYDPV
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagtcgacacagatcatccgacaccgcccatacgttctcgccgcgccgccgtacg
gtcgtcaaggccgcggccgccaccgccgtcctggccgggccgctcgccgccgcactgccc
gcccgcgcggccaccgagacccccgccttcctgcacggcgtggcctccggcgacccgctc
cccgacggcatcctgctgtggacccgggtgacgcccaccgccgaggcgatacccggctcc
gggctcggccccgacaccgaggtgagctggacggtggccaaggacaagacgttcaccgcg
atcgtcgccaagggctccaccaccgcgaccgccgcctccgaccacaccgtcaaggcggac
atccgcggcctccagccggccacggactacttcttccgcttctcggccggcggcaccgac
tcgcccgtcgcccgcacccgcaccgccccggccgccgacgcgggcgtggccggtctgcgc
ttcggcgtggtctcgtgcgccaactgggaggccggctacttctccccgtaccgccacctg
gccgcgcgcggcgacctggacgcctggctgcatctgggcgactacatctacgagtacaag
tccggcgagtacgcggcccgcggcaaggtcgtacgcccgcacgcccccgccaacgagatc
ctcaccctcgccgactaccgcacccggcacggccgttacaagacggacccggacctccag
gccctgcatcacaaggcgccggtcgtcgcgatctgggacgaccacgagttcgccgacaac
gcgtggtcgggcggcgcggggaaccacaccgagggcgccgagggcacctggacggcacgt
caggccgccgcgaaacaggcctacttcgagtggatgccggtccgcccggcgatcgagggg
accacctaccggcggctgcgcttcggcaagctcgccgacctctcgctgctcgacctgcgg
tccttccgctcgcagcaggcgtccacgggcagcggcacggtcgacgacccggagcgtacg
ctcacgggccgggtccagctcgactggctgaaggcggggctcaaggcgtccgacaccacc
tggcggctggtcggcaactcggtgatgatctcgccgttcgccatcggtgagctctccgcc
gacctcttcaagccgctcgccaagctgctcgggctgccgcaggagggcatcgccctcaac
accgaccagtgggacggctacacggacgaccgccgtgaactcctcgcccacctgcggaac
aacgcgatccgcaacacggtcttcctgaccggcgacatccacatggcgtgggccaacgac
gtgccgttcgacgccggtacgtacccgctgtccgcgtcggccggcaccgagttcgtggtc
acgtcggtcacctccgacaacctcgacgacatcgtcaaggtccccgagggcaccgtctcg
gccgtggccgcgccgctcatccgcgccgccaaccggcacgtccactgggtcgacaccgac
cggcacggctacggcgtcctggacatcaccgccgaccgcgcgcagatggactactacgtg
ctctccgaccgcacggacccgaacgcgacctcgtcctgggcccgctcgtaccgcacgcgc
agcggcacgcagaaggtggagcggacgtacgatccggtgtga

DBGET integrated database retrieval system