KEGG   Streptomyces avermitilis: SAV_6177Help
Entry
SAV_6177          CDS       T00126                                 

Gene name
trpB
Definition
(GenBank) putative tryptophan synthase beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sma  Streptomyces avermitilis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAV_6177 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAV_6177 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAV_6177 (trpB)
Enzymes [BR:sma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SAV_6177 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
7422537..7423823
Genome map
AA seq 428 aa AA seqDB search
MSSEFFIPDPEGQVPTAEGYFGAFGGKFIPEALVAAVDEVAVEYDKAKADPEFARELDDL
LVHYTGRPSALTEVSRFAEHAGGARVFLKREDLNHTGSHKINNVLGQALLTRRMGKTRVI
AETGAGQHGVATATACALFGLDCTIYMGEIDTQRQALNVARMRMLGAEVIAVKSGSRTLK
DAINEAFRDWVANVDRTHYLFGTVAGPHPFPAMVRDFHRVIGVEARRQILERAGRLPDAA
VACVGGGSNAIGLFHAFIPDTGVRLIGCEPAGHGLETGEHAATLTAGEPGILHGSRSYVL
QDDEGQITEPYSISAGLDYPGIGPEHAYLKDSGRGEYRAVTDDAAMQALRLLSRTEGIIP
AIESAHALAGALEIGKELGKDGLILVNLSGRGDKDMDTAARYFGLYDTDASVAADADSDI
AEIEGDAK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcgagttcttcattcccgaccccgagggtcaagtccccaccgccgagggctac
ttcggcgctttcggcggcaagttcatcccggaggccctggtcgccgccgtggacgaggtc
gccgtcgagtacgacaaggccaaggccgaccccgagttcgcccgtgaactggacgacctg
ctcgtccactacaccggccgcccgagcgccctcaccgaggtctcccgcttcgccgagcac
gccggtggcgcccgcgtcttcctgaagcgggaggacctcaaccacaccggctcccacaag
atcaacaacgtgctcgggcaggccctgctcacccggcgcatgggcaagacccgcgtcatc
gcggagaccggcgcgggacagcacggcgtcgccaccgccaccgcctgtgcgctcttcggc
ctcgactgcaccatctacatgggcgagatcgacacccagcgccaggccctcaacgtcgcg
cggatgcgcatgctcggcgccgaggtcatcgccgtgaagtccggcagccgcaccctcaag
gacgccatcaacgaggcgttccgggactgggtcgccaacgtcgaccgcacccactacctc
ttcgggaccgtcgccggcccccaccccttccccgccatggtgcgcgacttccaccgcgtc
atcggggtcgaggcgcgccggcagatcctggagcgcgccggacgtctgcccgacgcggcc
gtcgcctgcgtcggcggcggctccaacgcgatcgggctgttccacgccttcatccccgac
accggcgtccgcctcatcggctgcgagcccgcgggccacggcctggagacgggtgagcac
gcggccaccctcaccgccggcgagcccggcatcctgcacggatcgcgctcgtacgtcctc
caggacgacgaagggcagatcaccgagccctactcgatctcggccgggctcgactacccg
ggcatcggacccgagcacgcctacctcaaggacagcggtcgcggcgagtaccgcgcggtc
accgacgacgcggccatgcaggccctgcgcctgctctcccgcaccgagggcatcatcccg
gccatcgagagcgcccacgcgctcgccggtgccctggagatcggcaaggaactgggcaag
gacgggctgatcctcgtcaacctgtccgggcgcggcgacaaggacatggacacggccgcc
cgctacttcggcctgtacgacaccgacgcgtccgtcgccgcggacgccgacagcgacatc
gccgagatcgagggggacgccaagtga

DBGET integrated database retrieval system