KEGG   Streptomyces avermitilis: SAV_6178Help
Entry
SAV_6178          CDS       T00126                                 

Gene name
trpA
Definition
(GenBank) putative tryptophan synthase alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sma  Streptomyces avermitilis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAV_6178 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAV_6178 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAV_6178 (trpA)
Enzymes [BR:sma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SAV_6178 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
7423820..7424653
Genome map
AA seq 277 aa AA seqDB search
MSGAAFSRQRGQLLSDTLAAAKAEGRSALIAYLPAGFPTVDGGIAAIKAVFDGGADVVEV
GLPHSDPVLDGPVIQTADDIALRGGVRIADVMRTVREAHEATGKPVLVMTYWNPIDRYGV
ERFTAELAEAGGAGCILPDLPVQESALWREHAEKHGLATVFVVAPSSKDARLAEITAAGS
GFVYAASLMGVTGTRASVGEQAQDLVRRTRATTDLPVCVGLGVSNATQAAEVAGFADGVI
VGSAFVKLMLDAEDEAAGLEAVRALAGELAKGVRGGD
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggcgccgcattttcccgtcagaggggccaactgctgagcgacaccctcgccgcc
gcgaaggcggaggggcggtccgccctcatcgcctatctgccggccgggttcccgaccgtc
gacgggggcatcgccgccatcaaggccgtcttcgacggcggcgccgatgtcgtcgaggtc
ggactcccgcacagcgaccccgtcctcgacggccccgtcatccagaccgccgacgacatc
gccctgcggggcggcgtcaggatcgccgacgtcatgcggacggtccgggaggcgcacgag
gcgacgggcaagccggtcctcgtgatgacgtactggaaccccatcgaccgctacggcgtc
gagcggttcaccgccgagctcgcggaagcgggcggagcgggctgcatcctgcccgacctc
ccggtgcaggagtcggcgctgtggcgggagcacgccgagaagcacggcctcgcgacggtc
ttcgtggtcgcgcccagcagcaaggacgcccggctcgccgagatcaccgcggcgggctcc
ggcttcgtgtacgcggcctcgctgatgggcgtcaccggtacccgcgcgtccgtgggcgag
caggcgcaggacctggtgcggcgcaccagggccaccaccgacctgcccgtctgcgtcggc
ctcggcgtctccaacgccacgcaggccgcggaggtcgccggcttcgccgacggcgtgatc
gtcgggtcggcgttcgtgaagctgatgctggacgccgaggacgaggcggcgggtcttgag
gccgtacgggcgctggccggcgaactggccaagggcgtgcgcggcggcgactga

DBGET integrated database retrieval system