KEGG   Streptomyces avermitilis: SAV_6298Help
Entry
SAV_6298          CDS       T00126                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sma  Streptomyces avermitilis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAV_6298 (tpiA)
   01230 Biosynthesis of amino acids
    SAV_6298 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAV_6298 (tpiA)
   00051 Fructose and mannose metabolism
    SAV_6298 (tpiA)
   00562 Inositol phosphate metabolism
    SAV_6298 (tpiA)
Enzymes [BR:sma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SAV_6298 (tpiA)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SAV_6298 (tpiA)
  Exosomal proteins of bladder cancer cells
   SAV_6298 (tpiA)
  Exosomal proteins of melanoma cells
   SAV_6298 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
7562063..7562839
Genome map
AA seq 258 aa AA seqDB search
MTSRMPLMAGNWKMNLNHLEAIAHVQKLAFALADKDYEACEVAVLPPYTDLRSVQTLVDG
DKLKIKYGAQDVSAHDSGAYTGEISGSMLAKLKCTYVAVGHSERRQYHHETDEIVNAKVK
ASFRHGLIPILCVGEELEVREAGNHVTHTLTQVEGGLKDVPAEQAETIVIAYEPVWAIGT
GKVCGADDAQEVCAAIRAKLAELYSQELADQVRIQYGGSVKSGNVAEIMAKPDIDGALVG
GASLDADEFVKIARFRDQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgacttcgcgcatgccgctgatggcgggcaactggaagatgaacctcaaccacctcgag
gccatcgcccacgtccagaagctcgccttcgccctggccgacaaggactacgaggcctgc
gaggtcgccgtcctgccgccctacaccgacctgcgctccgtgcagaccctggtcgacggc
gacaagctcaagatcaagtacggcgcccaggacgtctcggcgcacgactccggcgcctac
accggcgagatctccggctcgatgctggccaagctcaagtgcacgtacgtggcggtcggc
cactccgagcgccggcagtaccaccacgagaccgacgagatcgtcaacgccaaggtcaag
gcctccttcaggcacggcctgatcccgatcctgtgcgtcggcgaggagctggaggtgcgc
gaggcgggcaaccacgtcacgcacacgctcacccaggtcgagggcggcctcaaggacgtc
ccggccgagcaggccgagaccatcgtgatcgcgtacgagcccgtctgggccatcggcacc
ggcaaggtctgcggcgccgacgacgcccaggaagtctgcgcggccatccgcgccaagctc
gccgagctgtactcccaggagctggccgaccaggtccgcatccagtacggcggctccgtg
aagtccgggaacgtcgcggagatcatggcgaagcccgacatcgacggcgccctggtcggc
ggtgcctcgctcgacgccgacgagttcgtcaagatcgcgcgcttccgcgaccagtga

DBGET integrated database retrieval system