KEGG   Streptomyces avermitilis: SAV_6376Help
Entry
SAV_6376          CDS       T00126                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
sma  Streptomyces avermitilis
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SAV_6376
   00500 Starch and sucrose metabolism
    SAV_6376
Enzymes [BR:sma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     SAV_6376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
7647694..7648833
Genome map
AA seq 379 aa AA seqDB search
MAGLPLSRRAFVAACTGAALAPVLAAPAHATTRAPFGRYGSPAARLTEQTLYVHPGGLGD
HTTVQAAVTAAGGTSQAFSTGGGSGRTLVLAPGIYRETVAVGVARTEMTWIGASGDPRDV
VVVYDNAAGTPRPGGGTYGTTGSATTTVQADGFTARSITFANDFLRADHPEITGTQAVAI
KVQGDRSAFLGCRFLGHQDTLYADSIALGTFARQYYRDCYVEGDVDFVFGRATAVYERCH
FHTLNRTDLAGAPYGFVFAPSTAAADPRGYLVTRGRVTSGAPDAYYKLARPWVPSSDPTA
RPMLTVRDTRLAAGIDAVAPYTNMSDSYPWQSQRFAEYRNSGPGAEVTVPGNRPQLTRGE
AGSATREAYLGDWTPWRGC
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggccggactcccgctcagcagacgggcgttcgtcgccgcgtgcaccggagccgcgctg
gctccggtactcgcggcccccgcccatgcgaccacgagggcgcctttcggacgctacggt
tcgcccgccgcccgcctcaccgagcagaccctgtacgtccatcccggcgggctcggcgac
cacaccaccgtccaggccgcggtgaccgcggctgggggtacctcccaggcgttcagcact
gggggaggcagcggccgcacgctcgtcctcgcgcccggcatctaccgcgagacggtcgcc
gtcggcgtcgcccgtacggagatgacctggatcggcgcctccggagacccgcgtgacgtc
gtcgtcgtgtacgacaacgcggccggcacgcccaggcccggcggcggcacctacggcacg
accggctcggccaccaccaccgtgcaggccgacggcttcaccgcccgctcgatcaccttc
gccaacgacttcctgcgcgccgaccaccccgagatcaccggcacccaggccgtcgcgatc
aaggtccagggcgaccggtcggccttcctggggtgccggttcctcggccaccaggacacg
ctgtacgccgactcgatcgcgctcggcacgttcgcccgccagtactaccgcgactgctac
gtcgagggtgatgtggacttcgtcttcggccgggcgacggccgtgtacgagcgctgccac
ttccacaccctgaaccgcacggacctggccggggccccgtacggcttcgtgttcgcgccg
tccaccgccgccgccgacccgcgcggctacctggtcacccgcggccgtgtcacgagcggg
gccccggacgcgtactacaagctcgcccgcccctgggtgcccagctcggaccccaccgcc
cggccgatgctgacggtccgtgacacccgcctcgccgccgggatcgacgcggtcgcgccc
tacaccaacatgtcggacagctatccgtggcagagccagcgcttcgccgagtaccggaac
tccggtccgggcgccgaggtcacggtccccgggaaccggccccagctcacccgcggggaa
gccgggtcggcgacccgcgaggcgtatctgggtgactggacgccatggagggggtgttga

DBGET integrated database retrieval system