KEGG   Streptomyces avermitilis: SAV_6407Help
Entry
SAV_6407          CDS       T00126                                 

Gene name
cobJ
Definition
precorrin methylase
Orthology
K13541  
cobalt-precorrin 5A hydrolase / precorrin-3B C17-methyltransferase [EC:3.7.1.12 2.1.1.131]
Organism
sma  Streptomyces avermitilis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sma00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(7681400..7683001)
Genome map
AA seq 533 aa AA seqDB search
MYDGPVGEAVRRAFAECEQLVCFLATGAVVRLVAPLLGDKTSDPGVVCVDEAGRFAVSLV
GGHGGGANELAREVGELLGAEPVVTTATDAVGLPGLDTLGFPVEGDVSGVSRALLDGEAV
ALDAEVSWPLPPLPVAAEGRYAIRLTDRLVEPGEREVVLRPPSLVVGVGASRNAPVEEVL
GLVQGALRDAGLSVKSLAELATVDAKADEPGIVEAAARLGVPLVTYSAGELAAVEVPNPS
DAPLAAVGTPSVAEAAALVRGGELLVPKRKSAAQPAMATCAVVRRPARGRLAVVGLGPGA
RDLLTPRARDELRRASVLVGLDQYVDQIRDLLRPGTRVLESGLGAEEERARTAVAEARRG
HAVALIGSGDAGVYAMASPALAEASDDIDVVGVPGVTAALAAGAILGAPLGHDHVSISLS
DLHTPWEVIERRVRAAAEADIVVTFYNPRSRGRGWQLPEALAILAGHREPTTPVGVVRNA
SRTDESSRLTTLAGLDPATVDMMTVVTVGNTATREIAGRMVTPRGYRWQEESE
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgacgggcccgtcggcgaggccgtgcggcgggccttcgcggagtgcgagcagctc
gtgtgtttcctggcgacgggcgcggtggtgcgtctggtggcgccgctcctcggcgacaag
acgtccgacccgggcgtcgtgtgcgtcgacgaggccggccggttcgccgtgtccctggtc
ggcggccatggcggcggcgccaatgaactcgcccgtgaggtgggcgagttgctgggggcc
gagcccgtcgtgacgacggcgacggacgccgtggggctgcccggcctcgacacgctcggc
ttccccgtggagggcgatgtctccggggtctcccgggccctgctggacggcgaggccgtg
gcgctggacgcggaggtgagctggccgctgccgccgctcccggtcgccgccgagggccgg
tacgcgatccggctcaccgatcgtctcgtcgagcccggcgaacgcgaggtcgtgctccgg
ccgccctccctcgtcgtcggcgtcggggcctccaggaacgcacccgtcgaggaggtcctc
ggcctggtccaaggcgccctgcgtgacgcggggctgtccgtgaagtccctcgccgagctc
gccaccgtcgacgccaaggccgacgagcccggcatcgtcgaggcggccgcgcggctcggg
gtgcccctggtgacgtactccgccggggaactggcggcggtcgaggtgccgaacccgtcc
gacgcgccgctcgccgccgtcggtacgccctccgtcgcggaggccgccgccctcgtacgc
gggggtgaactcctcgtgccgaagcgcaagtcggccgcacagccggcgatggcgacctgt
gccgtcgtacggcggccggcccgcgggcgcctcgccgtcgtgggactgggacccggcgcc
cgggatctgctcacgccccgcgccagggacgaactccgccgcgcctccgtgctcgtgggg
ctcgaccagtacgtcgaccagatccgcgacctgctgcgccccggtacccgggtcctggag
tcggggctcggcgccgaggaggagcgggcccgcacggcggtggccgaggcccggcgcggg
cacgccgtcgcgctgatcggcagcggggacgccggtgtgtacgcgatggcgtcgcccgcg
ctggccgaggcgtccgacgacatcgacgtggtcggcgtgccgggcgtcacggcggcgctg
gcggccggggcgatcctcggggcgccgctgggccacgaccatgtgtcgatcagcctttcc
gacctgcacacgccgtgggaggtcatcgagcggcgggtacgggccgccgccgaggcggac
atcgtggtgacgttctacaacccgcgcagccggggccggggctggcagctgcccgaggcg
ctcgcgatcctcgccggacaccgggagccgacgacgcccgtcggtgtcgtacgcaacgcc
tcgcggacggacgagtccagccgcctcaccacgctcgcgggactggatccggcgacggtg
gacatgatgacggtcgtgaccgtggggaacacggcgacccgtgagatcgccgggcgcatg
gtgacgccgcgcggctaccgctggcaggaggagtccgagtga

DBGET integrated database retrieval system