KEGG   Streptomyces avermitilis: SAV_6407Help
Entry
SAV_6407          CDS       T00126                                 

Gene name
cobJ
Definition
precorrin methylase
Orthology
K13541  
cobalt-precorrin 5A hydrolase / precorrin-3B C17-methyltransferase [EC:3.7.1.12 2.1.1.131]
Organism
sma  Streptomyces avermitilis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SAV_6407 (cobJ)
Enzymes [BR:sma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.131  precorrin-3B C17-methyltransferase
     SAV_6407 (cobJ)
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.12  cobalt-precorrin 5A hydrolase
     SAV_6407 (cobJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(7681400..7683001)
Genome map
AA seq 533 aa AA seqDB search
MYDGPVGEAVRRAFAECEQLVCFLATGAVVRLVAPLLGDKTSDPGVVCVDEAGRFAVSLV
GGHGGGANELAREVGELLGAEPVVTTATDAVGLPGLDTLGFPVEGDVSGVSRALLDGEAV
ALDAEVSWPLPPLPVAAEGRYAIRLTDRLVEPGEREVVLRPPSLVVGVGASRNAPVEEVL
GLVQGALRDAGLSVKSLAELATVDAKADEPGIVEAAARLGVPLVTYSAGELAAVEVPNPS
DAPLAAVGTPSVAEAAALVRGGELLVPKRKSAAQPAMATCAVVRRPARGRLAVVGLGPGA
RDLLTPRARDELRRASVLVGLDQYVDQIRDLLRPGTRVLESGLGAEEERARTAVAEARRG
HAVALIGSGDAGVYAMASPALAEASDDIDVVGVPGVTAALAAGAILGAPLGHDHVSISLS
DLHTPWEVIERRVRAAAEADIVVTFYNPRSRGRGWQLPEALAILAGHREPTTPVGVVRNA
SRTDESSRLTTLAGLDPATVDMMTVVTVGNTATREIAGRMVTPRGYRWQEESE
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgacgggcccgtcggcgaggccgtgcggcgggccttcgcggagtgcgagcagctc
gtgtgtttcctggcgacgggcgcggtggtgcgtctggtggcgccgctcctcggcgacaag
acgtccgacccgggcgtcgtgtgcgtcgacgaggccggccggttcgccgtgtccctggtc
ggcggccatggcggcggcgccaatgaactcgcccgtgaggtgggcgagttgctgggggcc
gagcccgtcgtgacgacggcgacggacgccgtggggctgcccggcctcgacacgctcggc
ttccccgtggagggcgatgtctccggggtctcccgggccctgctggacggcgaggccgtg
gcgctggacgcggaggtgagctggccgctgccgccgctcccggtcgccgccgagggccgg
tacgcgatccggctcaccgatcgtctcgtcgagcccggcgaacgcgaggtcgtgctccgg
ccgccctccctcgtcgtcggcgtcggggcctccaggaacgcacccgtcgaggaggtcctc
ggcctggtccaaggcgccctgcgtgacgcggggctgtccgtgaagtccctcgccgagctc
gccaccgtcgacgccaaggccgacgagcccggcatcgtcgaggcggccgcgcggctcggg
gtgcccctggtgacgtactccgccggggaactggcggcggtcgaggtgccgaacccgtcc
gacgcgccgctcgccgccgtcggtacgccctccgtcgcggaggccgccgccctcgtacgc
gggggtgaactcctcgtgccgaagcgcaagtcggccgcacagccggcgatggcgacctgt
gccgtcgtacggcggccggcccgcgggcgcctcgccgtcgtgggactgggacccggcgcc
cgggatctgctcacgccccgcgccagggacgaactccgccgcgcctccgtgctcgtgggg
ctcgaccagtacgtcgaccagatccgcgacctgctgcgccccggtacccgggtcctggag
tcggggctcggcgccgaggaggagcgggcccgcacggcggtggccgaggcccggcgcggg
cacgccgtcgcgctgatcggcagcggggacgccggtgtgtacgcgatggcgtcgcccgcg
ctggccgaggcgtccgacgacatcgacgtggtcggcgtgccgggcgtcacggcggcgctg
gcggccggggcgatcctcggggcgccgctgggccacgaccatgtgtcgatcagcctttcc
gacctgcacacgccgtgggaggtcatcgagcggcgggtacgggccgccgccgaggcggac
atcgtggtgacgttctacaacccgcgcagccggggccggggctggcagctgcccgaggcg
ctcgcgatcctcgccggacaccgggagccgacgacgcccgtcggtgtcgtacgcaacgcc
tcgcggacggacgagtccagccgcctcaccacgctcgcgggactggatccggcgacggtg
gacatgatgacggtcgtgaccgtggggaacacggcgacccgtgagatcgccgggcgcatg
gtgacgccgcgcggctaccgctggcaggaggagtccgagtga

DBGET integrated database retrieval system