KEGG   Streptomyces avermitilis: SAV_6414Help
Entry
SAV_6414          CDS       T00126                                 

Gene name
chlI
Definition
magnesium-chelatase subunit
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
sma  Streptomyces avermitilis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sma00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(7688710..7690779)
Genome map
AA seq 689 aa AA seqDB search
MSTPFPFTAVVGQDDLRLALLLNAVSPAVGGVLVRGEKGTAKSTAVRALSALMPEVDVVA
GCRFSCAPGSPDPACPDGPHEVGPGVRRPARMVELPVGASEDRLVGALDIERALAEGVKA
FEPGLLADAHRGILYVDEVNLLHDHLVDLLLDAAAMGASYVEREGVSVRHAARFLLVGTM
NPEEGELRPQLLDRFGLTVEVAASREPDQRVEVVRRRLAYDDDPEAFAARWADEESAVRA
RIVAARELLPSVRLGDGALRQIAATCAAFEVDGMRADIVMARTATALAAWDGRSDVLAED
VRQAALLALPHRRRRNPFDAPGLDENKLDETLEEFGGQNEDEGDDDPDPDGPGGGGQPPE
NGPEGGPQDGPQDGSQEGPQDGADSSEPGGDEAARPQAGESGQPGASGAGEQQAVRAGEP
FRTKVLSVPGLGEGAAGRRSRARTEHGRTTGARRPRGTLTKLHLAATVQAAAPHQRARGR
SGRGLVVRRDDLRQATREGREGNLVLFVVDASGSMAARQRMSAVKGAVLSLLLDAYQRRD
KVGLVTFRGSAAEVALPPTSSVDAAAVRLESLPTGGRTPLATGLLKAHDVLRVERLRDAA
RRPLVVVVTDGRATGGPEPVALAGRAARLFAADGVASVVVDCESGPVRLGLAGQLAGELG
GTPVTLDELRADSIAGLVRDVQSSNRRAA
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaccccgtttccgttcacggccgtggtcggccaggacgatctgcggctcgcgctg
ctgctgaacgccgtgtcgcccgcggtgggcggcgtgctggtccgcggcgagaagggcacg
gccaagtccacggccgtacgcgcgctttcggccctcatgcccgaggtggacgtcgtcgcg
ggctgccgcttctcgtgtgcgcccggctcccccgacccggcgtgcccggacggaccgcac
gaggtcgggccgggcgttcggcgtcccgcgcgcatggtcgaactgcccgtcggcgcctcc
gaggaccggctcgtgggcgcgctcgacatcgagcgggcgctcgcggagggtgtgaaggcc
ttcgagcccggcctgctggccgacgcgcaccgcgggatcctgtacgtcgacgaggtcaac
ctcctccacgaccacctggtcgacctgctcctggacgcggccgcgatgggtgcctcgtac
gtggaacgcgagggcgtctccgtacggcatgccgcccgcttcctgctcgtcgggaccatg
aatcccgaagagggcgagctgcggccgcagttgctcgaccggttcgggctcaccgtcgag
gtcgcggcctcgcgggagcccgatcagcgggtcgaggtcgtccggcgcaggctcgcgtac
gacgacgatccggaggccttcgccgcgcgctgggccgacgaggagtccgccgtgcgggcc
cggatcgtggccgcgcgggagctgttgccgtccgtgcggctcggcgacggggcgctgcgg
cagatcgcggcgacctgcgcggccttcgaggtcgacgggatgcgggccgacatcgtgatg
gcgcggacggcgaccgcgctggccgcgtgggacgggcgctccgatgtgctcgccgaggac
gtacggcaggcggcgctgctcgcgctgccgcaccggcggcgccggaatccgttcgacgcg
ccggggctcgacgagaacaagctcgacgagacgctggaggagttcggcggccaaaacgag
gacgaaggcgacgacgatccggatccggacgggccgggcggtggcgggcagccaccggag
aacggccccgagggcggacctcaggacggccctcaggacggatctcaggaagggcctcag
gacggggccgacagctcggaaccgggtggtgacgaggccgcgcggcctcaggccggtgag
tcggggcagccgggggcgtccggtgccggtgagcagcaggccgtgcgggccggtgagccg
ttccgtacgaaggtgctgagcgtgcccggtctcggcgagggcgcggcgggccggcgttcg
cgcgcgcggaccgagcacgggcgcacgaccggggcccggcggccccgggggacgctcacc
aagctgcacctggcggcgaccgtgcaggccgcggcaccccatcagcgggcgcgcggccgg
tcggggcgtgggctcgtcgtacggcgggacgatctgcggcaggccacccgtgaggggcgt
gagggcaacctcgtgctcttcgtggtcgacgcctccgggtcgatggcggcccggcagcgg
atgagcgccgtcaagggcgcggtgctgtcgctgctgctcgacgcgtatcagcggcgggac
aaggtggggctggtgaccttccgcgggtccgcggccgaggtggcgctgccgcccacctct
tcggtggacgcggccgcggtgcggctggagtcgctgcccacgggcgggcggacgccgctg
gccacggggttgctcaaggcgcacgacgtgctgcgggtggagcggctgcgggatgcggca
cgccggccgctggtcgtcgtggtgacggacgggcgggcgacgggcggccccgagccggtg
gcgctcgcgggccgggcggcgcggctgttcgcggccgacggggtcgcgtccgtggtcgtc
gactgcgagtcggggccggtgcggctcgggctggccgggcagctcgccggggagctgggc
gggacgcccgtcacgctggacgagttgcgggccgactcgatcgccgggctcgtacgagac
gttcagtcaagcaacaggagggccgcgtaa

DBGET integrated database retrieval system