KEGG   Streptomyces avermitilis: SAV_6421Help
Entry
SAV_6421          CDS       T00126                                 

Gene name
fucA2
Definition
fuculose-1-phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
sma  Streptomyces avermitilis
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sma00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
7699943..7700668
Genome map
AA seq 241 aa AA seqDB search
MAEQRRDGRDAGGVREHPQERREEGQRDEVARAWDDLVATARRTVSDGLVVGTSGNVSVR
VGDTVLVTPTGVPYERLTPADVVGVGLDGRQVLGSLVPTSELPMHLAVYRTTDARAVVHT
HAVHATAVSTLVPELPLIHYMAGALGGPVRVAPYATYGTPQLAENMRRALEDRTACLLQN
HGTIAYGATLPQAYDRTAQLEWMCRVWLTASSIPGLTPTLLTEEQVAEAGERLRGYGQPG
R
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcagcggcgcgacgggcgggatgcggggggcgtgcgggagcacccccaggag
cggcgcgaggaggggcagcgggacgaggtggcccgggcctgggacgacctcgtggccacc
gcccgccgcacggtgtccgacggtctggtcgtcggcacgtcgggcaatgtctccgtgcgc
gtgggggacaccgtcctggtcacacccacgggagtgccctacgagcggctgacgcccgcc
gatgtcgtgggcgtcggcctcgacggccggcaggtgctcggttcgctggtcccgacgagc
gaactgcccatgcatctggcggtctaccgcaccaccgacgcgcgcgccgtcgtccacacg
cacgccgtgcacgccacggccgtgtcgacgctcgtaccggagctgccgctgatccactac
atggcgggcgcgctcggcgggccggtccgggtcgccccctacgcgacgtacggcacgcca
cagttggccgaaaacatgcgacgggccctcgaggaccgcacggcctgcctcctccagaac
cacggcacgatcgcctacggcgcgaccctgccccaggcgtacgaccgcacggcccaactc
gagtggatgtgccgcgtatggctgacggcgtcctcgataccgggcctgaccccgacgctc
ctcacggaggaacaggtggcggaggcgggggagcgcctgcgggggtacgggcagccgggg
cggtag

DBGET integrated database retrieval system