KEGG   Streptomyces avermitilis: SAV_6661Help
Entry
SAV_6661          CDS       T00126                                 

Definition
oxidase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
sma  Streptomyces avermitilis
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SAV_6661
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     SAV_6661
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     SAV_6661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(7966414..7967007)
Genome map
AA seq 197 aa AA seqDB search
MTLLTTWPESGPETVVRRTSDPAEIAAALAPLGVRYEQWPVRADVPADADSDTVFAAYGP
EIDRLNAEEGFTTVDVLGLHPSDDPEYPVKAKAARAKFLQEHTHDDDDEVRFFVSGSGIF
YLHVNGEVHAVYCEKGDLLGVPRGTTHWFDMGTRPAFTAIRFFHEEDGWIGSFTGSTIAS
RFPDYDTIHAGHVGSAA
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgctgacgacctggcccgagtccggaccggagaccgtggtgcgccgcacctcc
gaccccgccgagatcgccgccgcgctcgcgccgctcggggtccgctacgagcagtggccg
gtccgcgcggacgtgccggcggacgcggacagcgacacggtgttcgccgcgtacggcccg
gagatcgaccggttgaacgccgaggagggcttcaccacggtcgatgtgctcgggctgcac
ccgagcgacgacccggagtacccggtgaaggcgaaggccgcgcgcgcgaagttcctccag
gagcacacgcacgacgacgatgacgaggtccgcttcttcgtctcgggctccgggatcttc
tatctgcatgtgaacggcgaggtccacgccgtgtactgcgagaagggcgacctgctgggc
gtgccgcgcggtacgacgcactggttcgacatggggacgcggcccgccttcaccgcgatc
cgcttcttccacgaggaggacggctggatcggcagcttcaccggctccaccatcgcgtcc
cggttcccggactacgacacgatccacgccggtcacgtgggttctgccgcatga

DBGET integrated database retrieval system