KEGG   Streptomyces avermitilis: SAV_6664Help
Entry
SAV_6664          CDS       T00126                                 

Gene name
glpK1
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sma  Streptomyces avermitilis
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sma00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(7970359..7971897)
Genome map
AA seq 512 aa AA seqDB search
MTDAHTAGPFIAAIDQGTTSSRCIVFDRDGRIVSVDQKEHEQIFPKPGWVEHNAAEIWTN
VQEVVAGAVEKAGITRDDIKAIGITNQRETTLLWDKNTGEPVHNALVWQDTRTDALCKEL
GRNVGQDRFRRETGLPLASYFAGPKARWLLDNVEGLRERAEAGDILFGTMDTWVIWNLTG
GVNGGKHVTDVTNASRTMLMNLHTMQWDDKIAESIGVPLAMLPEIRSSAEVYGEITGGKL
GDLLGGIPVASALGDQQAALFGQTCFSEGEAKSTYGTGTFMLMNTGDKIINSYSGLLTTV
GYQIGDQKPVYALEGSIAVTGSLVQWMRDQMGLIKSAAEIETLASSVEDNGGAYFVPAFS
GLFAPYWRSDARGVIAGLTRYVTKAHIARAVLEATAWQTREITDAMTKDSGVELAALKVD
GGMTSNNLLMQTLSDFLDAPVVRPMVAETTCLGAAYAAGLAVGFWTNTEDLRANWRRAAE
WTPNMAAETRDREYKSWLKAVERTMGWIEDEE
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacgcacacaccgccggccccttcatcgccgcgatcgaccagggcaccacgtcc
agccgttgcatcgtcttcgaccgggacggccgtatcgtctccgtcgaccagaaggagcac
gagcagatcttcccgaagccgggctgggtcgagcacaacgccgccgagatctggaccaac
gtccaggaggtcgtcgccggagccgtcgagaaggccggcatcacccgcgacgacatcaag
gccatcggcatcaccaaccagcgcgagaccacgctgctctgggacaagaacaccggtgag
cccgtccacaacgccctcgtctggcaggacacccgcaccgacgcgctctgcaaggaactc
ggccgcaacgtcggccaggaccgcttccgccgcgagaccggcctgccgctcgcgtcgtac
ttcgccggcccgaaggcccgctggctgctggacaacgtcgagggcctgcgcgagcgcgcc
gaagccggcgacatcctcttcggcaccatggacacctgggtcatctggaacctgacgggt
ggtgtcaacggcggcaagcacgtcaccgacgtcaccaacgcctcccgcaccatgctgatg
aacctgcacaccatgcagtgggacgacaagatcgccgagtccatcggtgtcccgctggcg
atgctgcccgagatccgctcctccgccgaggtgtacggcgagatcaccggcggcaagctc
ggcgacctgctcggcggcatccccgtcgcctccgcgctcggcgaccagcaggcggccctg
ttcggccagacctgtttctccgagggcgaggccaagtccacgtacggcaccggcacgttc
atgctgatgaacaccggtgacaagatcatcaactcgtacagcgggctgctgaccaccgtg
ggctaccagatcggcgaccagaagccggtctacgccctcgagggttccatcgccgtcacc
ggttcgctcgtgcagtggatgcgcgaccagatgggcctgatcaagtccgccgccgagatc
gagacgctcgcgtcgtcggtcgaggacaacggcggcgcctacttcgtgccggccttctcc
ggtctgttcgccccgtactggcgctccgacgcccgcggtgtgatcgccggtctcacccgg
tacgtcaccaaggcgcacatcgcgcgcgccgtcctggaggccacggcctggcagacccgc
gagatcaccgacgccatgacgaaggactccggcgtcgagctcgcggccctcaaggtcgac
ggcggcatgacctccaacaacctgctgatgcagacgctctcggacttcctggacgcgccg
gtggtgcgtccgatggtcgccgagaccacctgcctcggcgccgcctacgccgccggtctc
gccgtcggcttctggaccaacaccgaggacctgcgggccaactggcgcagggccgcggag
tggaccccgaacatggccgcggagacccgcgaccgtgagtacaagagctggctcaaggcc
gtcgagcggaccatgggctggatcgaggacgaggagtaa

DBGET integrated database retrieval system