KEGG   Streptomyces avermitilis: SAV_6863Help
Entry
SAV_6863          CDS       T00126                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sma  Streptomyces avermitilis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sma00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sma00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
8190239..8191216
Genome map
AA seq 325 aa AA seqDB search
MQRHLISAADLTRDDAVHLLDTAEEMARVADRPIKKLPTLRGRTVVNLFFEDSTRTRISF
EAAEKRLSADVINFTAKGSSVSKGESLKDTAQTLEAMGVDAVVIRHGASGAPYRLATSGW
IDAVVINAGDGTHQHPTQALLDAFTMRRRLVGRDAGLGRDLAGKRITLVGDILHSRVARS
NVDLLHTLGAEVTLVAPPTLLPVGIESWPCEVAYDLDSTLPKSDAVMMLRVQRERMNAAF
FPTEREYSRRYGLNGDRMAKMPEHAIVMHPGPMVRGMEITAEVADSDRCTAIEQVTNGVS
IRMAVLYLLLGGNEPAVSHTRIEEK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgtcatctcatctcggccgccgacctcacccgcgacgacgccgtccatctcctc
gacaccgccgaggagatggcccgggtggcggaccggccgatcaagaaactgccgaccctg
cgcggccgcaccgtcgtcaacctcttcttcgaggactccacccgcacccggatctccttc
gaggccgccgagaagcgcctctccgcggacgtcatcaacttcaccgccaagggatccagc
gtctccaagggcgagtcgctcaaggacaccgcccagaccctggaggcgatgggcgtcgac
gccgtcgtcatccggcacggcgcttccggagccccgtaccggctcgccacctccggctgg
atcgacgcggtcgtcatcaacgccggcgacggcacccatcagcaccccacgcaggccctg
ctcgacgccttcaccatgcgccgccggctcgtcggccgggacgccgggctcggccgggac
ctggccggcaagcgcatcacgctcgtcggtgacatcctgcacagccgcgtcgcccgctcg
aacgtggacctgctgcacaccctcggcgccgaggtcaccctggtcgccccgcccaccctg
ctgccggtcggcatcgagtcctggccctgcgaggtcgcgtacgacctcgacagcacgctg
cccaagtccgacgcggtgatgatgctccgcgtccagcgcgagcggatgaacgccgcgttc
ttcccgaccgagcgcgagtactcccggcgctacggcctcaacggcgaccgcatggcgaag
atgcccgagcacgccatcgtgatgcaccccggtcccatggtccgcggcatggagatcacc
gccgaggtcgccgactccgaccgctgcaccgcgatcgaacaggtcaccaacggcgtctcg
atccggatggccgttctgtatctgctccttggcggcaacgaacccgccgtcagccacacc
cgtatcgaggagaagtaa

DBGET integrated database retrieval system