KEGG   Streptomyces avermitilis: SAV_6896Help
Entry
SAV_6896          CDS       T00126                                 

Gene name
celA5
Definition
endo-1,4-beta-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sma  Streptomyces avermitilis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SAV_6896 (celA5)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     SAV_6896 (celA5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
8228717..8229829
Genome map
AA seq 370 aa AA seqDB search
MVAVASFVVAVGTATGMMSAFDDGRTPDQARPQVTGPPSRRPLPAVPSPSPATTSARPSP
ATPSAGPGPKSSPSKREPTTAAAPAQLYRHPESQVLDWVGAHPDDARRAVIESRIADRPA
AVWFADFAPSTITARVRAVTAAAAAQDRVPVVVPYTIPDRDCGGASQGGAPDLAAYDAWI
DKFAAGLGSGEVIVILEPDSVAQSDCLSEGRQADRFASLARAGRVLKAANPGVRVYFDGG
HSEWNPAAKQASLLDQAGAASPAASDGIFTNVSNFHRTSDEIAYARQVLAGLGGPASLGA
VIDTSRNGNGAPAGGEWCDPAGRKIGRAPTLTTGEAGIDAYLWVKLPGESDGCKGTPGTF
SPAYAYELAR
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggtggcggtggcctcgttcgtggtcgccgtcggcaccgcgacggggatgatgtcggcg
ttcgacgacggccgtacgcccgaccaggcccgcccgcaagtgaccggcccgcccagccgc
cggccgctgcccgccgtcccgtccccgtcgcccgccacgacgtccgcgaggccgagtccg
gccaccccgtcggccgggcccggcccgaagtcctccccgagcaagagggagccgaccact
gcggccgcccccgcccagctctatcgccaccccgaatcccaggtcctcgactgggtcggc
gcgcatccggacgacgcccggcgcgcggtcatcgagtcccgcatcgccgaccggcccgcc
gcggtctggttcgccgacttcgctccgtcgaccatcaccgcccgggtcagggcggtcacg
gcggccgccgccgcgcaggaccgggtcccggtcgtcgtgccgtacacgatcccggaccgc
gactgcggcggggcgtcgcagggcggcgcgcccgatctcgccgcttacgacgcctggatc
gacaagttcgccgccgggctcggctccggcgaggtcatcgtcatactggagcccgactcg
gtcgcccagtccgactgtctgtccgaggggcggcaggccgaccgcttcgcctcgctggct
cgcgcgggccgggtcctcaaggccgcgaaccccggggtccgggtctacttcgacggcggg
cactccgagtggaatccggccgccaaacaggcctcgctgctcgaccaggcgggcgccgcc
tcgcccgccgcctccgacggcatcttcacgaacgtgtccaacttccaccgtacgagcgac
gagatcgcgtacgcccggcaggtgctggccggcctcggcggccccgcgagcctgggcgcc
gtcatcgacaccagccgcaacggcaacggcgcgccggccggcggcgagtggtgcgatccg
gcgggccggaagatcggccgggcgccgaccctgacgaccggggaggccgggatcgacgcc
tacctgtgggtgaagctgccgggcgagtccgacgggtgcaagggcacgcccgggaccttc
tcgcccgcctacgcctatgaactggcgcgctga

DBGET integrated database retrieval system