KEGG   Streptomyces avermitilis: SAV_717Help
Entry
SAV_717           CDS       T00126                                 

Gene name
echA3
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sma  Streptomyces avermitilis
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SAV_717 (echA3)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SAV_717 (echA3)
   00650 Butanoate metabolism
    SAV_717 (echA3)
  Lipid metabolism
   00071 Fatty acid degradation
    SAV_717 (echA3)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAV_717 (echA3)
   00310 Lysine degradation
    SAV_717 (echA3)
   00360 Phenylalanine metabolism
    SAV_717 (echA3)
   00380 Tryptophan metabolism
    SAV_717 (echA3)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAV_717 (echA3)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAV_717 (echA3)
   00281 Geraniol degradation
    SAV_717 (echA3)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAV_717 (echA3)
   00627 Aminobenzoate degradation
    SAV_717 (echA3)
   00930 Caprolactam degradation
    SAV_717 (echA3)
Enzymes [BR:sma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SAV_717 (echA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(869743..870525)
Genome map
AA seq 260 aa AA seqDB search
MSTAPEAADLVLHERHGGVLTITINRPAQKNAVDHEAAVQLAAAVDLLDADPELSVGVLT
GAGGVFSAGMDLKAFAKGELPLLPSRGLGGLTRASVRKPLVAAVEGWALGGGFELVLACD
LIVAAEDARFGFPEVMRGLVAAEGGLVRLPRRLPYHVAARVLLTGEPLTAVEAKEYGLVN
ELTPPGAALDAARELAGRVARNAPLALAAVKEVLRETQGLKESDAFRRQDELTSGLAASE
DAREGAQAFAEKRAPVWHGR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggcgcccgaagctgccgacttggtgctccacgagcgtcacggcggcgtactg
accatcaccatcaaccgccccgcgcagaagaacgccgtcgaccacgaggccgcggtacag
ctcgcggcggccgtggatctgctcgacgcggacccggagctgtcggtcggcgtcctcacg
ggcgcgggcggggtgttcagcgcgggcatggacctgaaggcgttcgccaagggcgagctg
cccttgctgcccagccggggcctgggcgggctcacccgcgcgtcggtgcgaaagccgctg
gtcgccgcggtcgagggctgggcgctcggcggtggcttcgagctggtcctcgcctgcgac
ctgatcgtcgccgcggaggacgcccgcttcgggtttcccgaggtcatgcgtggtctcgtg
gcggcggagggcggactggtcaggctgccgcgccgacttccgtaccacgtcgccgcgcgc
gtactgctgacgggcgagccgctgaccgccgtcgaagccaaggagtacgggctcgtcaat
gagctgaccccgcccggcgccgcgctggacgcggcccgggagctcgcgggccgcgtcgcg
cggaacgcaccgcttgcactggcggccgtcaaggaggtcctgcgcgagacacagggcctg
aaggagagcgacgcgttcagacgccaggacgagctcacgagcggactggccgccagcgag
gacgcgcgggaaggcgcacaggcgttcgccgagaaacgcgccccggtctggcacggccgc
tga

DBGET integrated database retrieval system