KEGG   Streptomyces avermitilis: SAV_7177Help
Entry
SAV_7177          CDS       T00126                                 

Gene name
thcA
Definition
aldehyde dehydrogenase
Orthology
K00138  
aldehyde dehydrogenase [EC:1.2.1.-]
Organism
sma  Streptomyces avermitilis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAV_7177 (thcA)
   00620 Pyruvate metabolism
    SAV_7177 (thcA)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     SAV_7177 (thcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(8543834..8545357)
Genome map
AA seq 507 aa AA seqDB search
MTRFAAPGTDGAIVSYQARYDHFIGGEYVPPARGQYFENPSPVNGQPFTEIARGTAEDVE
RALDAAHAVAPAWGRTSVAERSDILRRIADRMEANLEKLAVAESWENGKPVRETLAADIP
LAIDHFRYFAGAIRAQEGSLGEVDDDTVAYHFHEPLGVVAQIIPWNFPILMATWKLAPAL
AAGNAVVLKPAEQTPASIHYWLSLVADLLPPGVLNIVNGFGVEAGKPLASSPRVAKVAFT
GETTTGRLIMQYASENITPVTLELGGKSPNIFFDDVWSANDDFRDKALEGFTMFALNQGE
VCTCPSRALVQRGQYAEFMEAAVARTELIKTGHPLDTDTMIGAQASNDQLEKILSYLDIG
RQEGAKILTGGERIEHDGELKGGYYVQPTIFEGDNRMRIFQEEIFGPVVSVTSFNDFDDA
IKIANDTLYGLGAGVWTRDINTAYRAGRAIQAGRVWTNCYHAYPAHAAFGGYKGSGIGRE
THKMMLDHYQQTKNLLVSYSPKKLGFF
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtttcgcagcgcccggcaccgacggcgcgatcgtctcctaccaggcgcgctat
gaccacttcatcggcggcgagtacgtgccgccggcccgcggacagtacttcgagaacccg
agcccggtgaacgggcagccgttcacggagatcgcgcggggcacggccgaggacgtggag
cgcgcgctcgacgccgcgcacgcggtcgcccccgcctggggccgcacgtccgtggcggag
cgctccgacatcctccgccgcatcgccgaccggatggaggcgaacctggagaagctggcg
gtcgcggagagctgggagaacggcaaaccggtccgtgagacgctggccgcggacattccg
ctggccatcgaccacttccgctacttcgcgggcgcgatccgcgcgcaggagggttccctc
ggcgaggtcgacgacgacacggtcgcgtaccacttccacgagccgctcggcgtggtcgcg
cagatcatcccgtggaacttcccgatcctgatggcgacgtggaagctcgccccggccctc
gcggcgggcaacgcggtcgtcctcaagcccgccgaacagaccccggcgtccatccactac
tggctgagcctggtggccgacctgctgccgccgggcgtgctgaacatcgtcaacgggttc
ggggtggaggcgggcaaaccgctcgcgtccagcccgcgggtggcgaaggtggcgttcacc
ggcgagaccacgacggggcggctgatcatgcagtacgcctccgagaacatcaccccggtc
acgctcgaactcggcggcaagtccccgaacatcttcttcgacgacgtctggtcggcgaac
gacgacttccgtgacaaggcgctcgaaggcttcacgatgttcgccctcaaccagggcgag
gtgtgcacctgcccgtcccgggcgctcgtccagcgcggccagtacgccgagttcatggag
gcggcggtcgcccgcaccgagctgatcaagaccggtcacccgctcgacacggacacgatg
atcggcgcccaggcgtccaacgaccagctggagaagatcctctcctatctggacatcggc
cggcaggagggcgcgaagatcctcaccggcggcgaacgcatcgagcacgacggtgagttg
aagggcggttactacgtccagccgaccatcttcgagggcgacaaccgtatgcggatcttc
caggaggagatcttcggtccggtcgtctcggtgacgtcgttcaatgacttcgacgacgcc
atcaagatcgccaacgacacgctgtacgggctcggcgcgggcgtatggacgcgggacatc
aacaccgcgtaccgcgcgggccgtgccatccaggcgggccgcgtctggacgaactgctac
cacgcctacccggcccacgcggcgttcggcggctacaagggctcgggcatcggccgcgag
acccacaagatgatgctggaccactaccagcagacgaagaacctactggtgtcgtactcg
ccgaagaagctgggcttcttctag

DBGET integrated database retrieval system