KEGG   Streptomyces avermitilis: SAV_7289Help
Entry
SAV_7289          CDS       T00126                                 

Gene name
mutM2
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
sma  Streptomyces avermitilis
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:sma03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
8693625..8694485
Genome map
AA seq 286 aa AA seqDB search
MPELPEVEALKDFLADHVVGHEVVRVLPVAISVLKTYDPPVTALEGREITAVRRHGKFLD
LEADGLHFVTHLARGGWLHWRDKLPDAPPRPGKGPLALRVALETGEGFDLTEAGTQKRLA
VHVVRDPGDVPGVARLGPDPLADDFDEARFARLLEGERRRIKGALRDQSLIAGVGNAYSD
EILHAAKMSPFKLTSALTAEEIRQLYAALRTTLTEAVERSRGLAAGRLKAEKKTGLRVHG
RTGEPCPVCGDTIREVSFSDSSLQYCPTCQTGGRPLADRRMSRLLK
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgccggaactgcccgaggtcgaagcgctcaaggacttcctggccgaccatgtcgtcggc
cacgaggtcgtgcgggtgctgcccgtcgcgatcagtgtcctgaagacgtacgaccccccg
gtcaccgcccttgagggccgggagatcacggcggtgcgccggcacggcaagttcctcgac
ctggaggcggacggcctgcacttcgtgacgcacctggcccgcggcggctggctccattgg
cgggacaagctgcccgacgccccgccccgccccggcaagggcccgctggcgctgcgtgtc
gcgctggagacgggagagggcttcgacctgacggaggccggcacacagaagagactggcc
gtccatgtcgtacgggacccgggtgacgtcccgggcgtggcccggctcggcccggacccg
ctcgccgacgacttcgacgaggcgcgcttcgcgcggcttctggagggcgagcggcgccgg
atcaagggcgcgctgcgcgaccagagcctgatcgcgggcgtggggaacgcgtacagcgac
gagatcctgcacgccgcgaagatgtcaccgttcaagctcacctcggccctgaccgccgag
gagatacgacagctgtacgcggcactgcgtacgacgctcaccgaggcggtcgagcgctcc
cgggggctggccgccgggcggctgaaggcggagaagaagaccgggctgcgggtgcacggc
agaacgggggagccctgtccggtgtgcggggacacgatccgcgaggtctccttcagcgac
tcctcgctccagtactgcccgacctgccagaccggcggcagacccctggcggaccggcgg
atgtcacggctgctcaagtag

DBGET integrated database retrieval system