KEGG   Streptomyces avermitilis: SAV_7398Help
Entry
SAV_7398          CDS       T00126                                 

Definition
glycogen branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sma  Streptomyces avermitilis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SAV_7398
Enzymes [BR:sma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SAV_7398
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAV_7398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
8826938..8827363
Genome map
AA seq 141 aa AA seqDB search
MNAHAVPPISTPAPPSGARPAPVAPGDRDRLLSGTHHDPHSVLGAHPVPGGVAFRVLRPY
ALSVTVVTDDLRTELHDDGAGFFTGLLPLRAVPDYRLHVAYEGTVHETETPTASCPRSAS
WTCTSSTRAGTRSCGRRSAPG
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcacatgctgttccccccatctccaccccggccccgccgtccggcgctcggccg
gccccggtggcaccgggtgaccgcgaccggctcctgtccgggacgcatcacgacccgcac
tccgtgctcggcgcgcatcccgtgcccggcggggtcgccttccgggtgctgcgcccgtac
gcgctgtccgtcaccgtcgtcaccgacgacctgcgcaccgagctgcacgacgacggcgcc
ggcttcttcaccggcctgctgccgctgcgcgccgtaccggactaccggctgcacgtggcc
tacgagggcacggtccacgagaccgagacgcctaccgcttcctgcccgcgctcggcgagc
tggacctgcacctcatcaacgagggccggcacgaggagctgtggacggcgctcggcgccc
gggtga

DBGET integrated database retrieval system