KEGG   Streptomyces avermitilis: SAV_7426Help
Entry
SAV_7426          CDS       T00126                                 

Gene name
cyp27
Definition
cytochrome P450
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
sma  Streptomyces avermitilis
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    SAV_7426 (cyp27)
  Amino acid metabolism
   00380 Tryptophan metabolism
    SAV_7426 (cyp27)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SAV_7426 (cyp27)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     SAV_7426 (cyp27)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(8857613..8859127)
Genome map
AA seq 504 aa AA seqDB search
MAQSTRTVIPKGFRSAELGWPELHRIPHPPHRLPVVGDVLGVNVRTPVQDSLRIGRRLGP
VFRRKAFGKEIVFVGGADLAAELADESRFAKHVGLGVANLRPVAGDGLFTAYNHEPNWQL
GHDVLAPGFSREAMAGYHPMMLAVTERLIDHWDREQTAGRAVDVPGDMTKLTLETIARTG
FGHDFGSFERARPHPFVTAMVGTLTYAQRRNVVPEPLAPLLLRTATRRNAADLAYLNRTV
DALVRARRTTSGEGDLLDRMLDTARPGTGERLAPENIRRQVITFLVAGHETTSGALSFAL
HYLSRHPDVAARARAEVDRVWGGTARPGYDQVAKLRYVRRVLDESLRLWPTAPAFAREAR
RDTVLGGVHPMREGAWALVLTAMLHRDPGVWGADAERFDPDRFDAQAVRSRAAHTFKPFG
TGARACIGRQFALHEATLVLGLLLRRYELRAEPGYRLRVAERLTLMPEGLRLRLDRRVPA
VEDVPVANPEVSSGPRCPVTGAGE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagtcgacgcggaccgtgattcccaaggggttccgcagcgcggagctgggctgg
ccggagctgcaccgcatcccgcatccgccccaccggcttccagtcgtcggcgatgtgctg
ggcgtcaacgtccgtactcccgtgcaggattcgctgcgcatcggccgccggctcggcccg
gtcttccggcgcaaggccttcggcaaggagatcgtcttcgtggggggtgcggacctcgcg
gccgaactggcggacgagtcgcggttcgccaagcacgtgggcctgggcgtcgccaatctg
cggccggtcgccggcgacggcctgttcacggcgtacaaccacgagccgaactggcagctc
ggccacgacgtcctggcgccgggcttcagccgtgaggccatggcggggtaccacccgatg
atgctggccgtgaccgagcggctgatcgaccactgggaccgggagcagacggcaggccgt
gccgtggacgtgccgggcgacatgaccaagctgacgctggagacgatcgcgcgcaccggg
ttcgggcacgacttcggctcgttcgaacgcgcccggccgcatcccttcgtcaccgcgatg
gtgggcaccctgacgtacgcccagcggcggaacgtcgttccggagccgctggctccgctg
ctgctgcgcaccgccacccgccgcaacgccgccgatctggcgtacctcaaccgcacggtc
gacgccctggtgcgcgcccgccggaccacgagcggcgaaggcgacctgctcgaccggatg
ctggacaccgcgcgtcccgggaccggggagcggctcgccccggagaacatacggcggcag
gtcatcacgttcctggtcgccggccacgagaccacctcgggcgcgctctccttcgccctg
cactacctctcccggcacccggacgtcgccgcgcgcgcccgcgccgaggtggaccgcgtg
tggggcggcacggcccggcccggctacgaccaagtcgccaagctgcgctacgtgcggcgg
gttctggacgagtcgctgcgcctgtggccgaccgcgcccgccttcgcccgggaggcccgc
cgggacacggtcctcggcggcgtccatccgatgcgggaaggcgcgtgggcgctggtcctg
acggcgatgctgcaccgggatccgggggtgtggggcgcggacgcggagcggttcgacccc
gaccggttcgacgcgcaggcggtgcgttcccgggccgcgcacaccttcaaaccgttcggg
acgggggcacgggcctgcatcgggcgccagttcgcgctgcacgaggcgacgctggtgctg
ggactgctgctgcgccggtacgagctgcgggccgagcccgggtaccggctgcgggtggcg
gagcggctgacgctgatgcccgaggggctgcggctgcggctggaccggcgggtgcccgcc
gtcgaggacgtcccggtcgcgaacccggaggtgtcctcaggtccccgctgtccagtgacc
ggggcgggtgagtga

DBGET integrated database retrieval system