KEGG   Streptomyces avermitilis: SAV_7426Help
Entry
SAV_7426          CDS       T00126                                 

Gene name
cyp27
Definition
cytochrome P450
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
sma  Streptomyces avermitilis
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:sma00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:sma00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:sma00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(8857613..8859127)
Genome map
AA seq 504 aa AA seqDB search
MAQSTRTVIPKGFRSAELGWPELHRIPHPPHRLPVVGDVLGVNVRTPVQDSLRIGRRLGP
VFRRKAFGKEIVFVGGADLAAELADESRFAKHVGLGVANLRPVAGDGLFTAYNHEPNWQL
GHDVLAPGFSREAMAGYHPMMLAVTERLIDHWDREQTAGRAVDVPGDMTKLTLETIARTG
FGHDFGSFERARPHPFVTAMVGTLTYAQRRNVVPEPLAPLLLRTATRRNAADLAYLNRTV
DALVRARRTTSGEGDLLDRMLDTARPGTGERLAPENIRRQVITFLVAGHETTSGALSFAL
HYLSRHPDVAARARAEVDRVWGGTARPGYDQVAKLRYVRRVLDESLRLWPTAPAFAREAR
RDTVLGGVHPMREGAWALVLTAMLHRDPGVWGADAERFDPDRFDAQAVRSRAAHTFKPFG
TGARACIGRQFALHEATLVLGLLLRRYELRAEPGYRLRVAERLTLMPEGLRLRLDRRVPA
VEDVPVANPEVSSGPRCPVTGAGE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagtcgacgcggaccgtgattcccaaggggttccgcagcgcggagctgggctgg
ccggagctgcaccgcatcccgcatccgccccaccggcttccagtcgtcggcgatgtgctg
ggcgtcaacgtccgtactcccgtgcaggattcgctgcgcatcggccgccggctcggcccg
gtcttccggcgcaaggccttcggcaaggagatcgtcttcgtggggggtgcggacctcgcg
gccgaactggcggacgagtcgcggttcgccaagcacgtgggcctgggcgtcgccaatctg
cggccggtcgccggcgacggcctgttcacggcgtacaaccacgagccgaactggcagctc
ggccacgacgtcctggcgccgggcttcagccgtgaggccatggcggggtaccacccgatg
atgctggccgtgaccgagcggctgatcgaccactgggaccgggagcagacggcaggccgt
gccgtggacgtgccgggcgacatgaccaagctgacgctggagacgatcgcgcgcaccggg
ttcgggcacgacttcggctcgttcgaacgcgcccggccgcatcccttcgtcaccgcgatg
gtgggcaccctgacgtacgcccagcggcggaacgtcgttccggagccgctggctccgctg
ctgctgcgcaccgccacccgccgcaacgccgccgatctggcgtacctcaaccgcacggtc
gacgccctggtgcgcgcccgccggaccacgagcggcgaaggcgacctgctcgaccggatg
ctggacaccgcgcgtcccgggaccggggagcggctcgccccggagaacatacggcggcag
gtcatcacgttcctggtcgccggccacgagaccacctcgggcgcgctctccttcgccctg
cactacctctcccggcacccggacgtcgccgcgcgcgcccgcgccgaggtggaccgcgtg
tggggcggcacggcccggcccggctacgaccaagtcgccaagctgcgctacgtgcggcgg
gttctggacgagtcgctgcgcctgtggccgaccgcgcccgccttcgcccgggaggcccgc
cgggacacggtcctcggcggcgtccatccgatgcgggaaggcgcgtgggcgctggtcctg
acggcgatgctgcaccgggatccgggggtgtggggcgcggacgcggagcggttcgacccc
gaccggttcgacgcgcaggcggtgcgttcccgggccgcgcacaccttcaaaccgttcggg
acgggggcacgggcctgcatcgggcgccagttcgcgctgcacgaggcgacgctggtgctg
ggactgctgctgcgccggtacgagctgcgggccgagcccgggtaccggctgcgggtggcg
gagcggctgacgctgatgcccgaggggctgcggctgcggctggaccggcgggtgcccgcc
gtcgaggacgtcccggtcgcgaacccggaggtgtcctcaggtccccgctgtccagtgacc
ggggcgggtgagtga

DBGET integrated database retrieval system