KEGG   Streptomyces avermitilis: SAV_7479Help
Entry
SAV_7479          CDS       T00126                                 

Gene name
bga8
Definition
beta-galactosidase precursor
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
sma  Streptomyces avermitilis
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SAV_7479 (bga8)
  Lipid metabolism
   00600 Sphingolipid metabolism
    SAV_7479 (bga8)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SAV_7479 (bga8)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SAV_7479 (bga8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
8909193..8912285
Genome map
AA seq 1030 aa AA seqDB search
MTVTRRSVLIAGTAAPAAGALTGIGGAPAVASAGAPGRHTVALRDGWRFALVNPGGITDP
TGAYADAADPGHDDSGWREVAVPHDWSIEQTPTTQYGTTSGTGFLPGGLGWYRTAFTLPS
ALAGKRISVEFDGVYMDSYVYCNGTEVGRHPYGYTGFAFDLTDLLHTDGTTENVIAVKVQ
NRLPSSRWYSGSGIYREARLVVTEPVHVRRWGTYVTTPDITEERAVVRVRTTVVDASGAG
SEVQVVSRIVGPDGRTAARTTSTVTVADQGTQTHELTVKKPQLWDFAHPHRYTLETELRV
GGKRTDTHRTTFGIRRVTVDPDEGFHLNGTHAKIRGVDLHHDQGALGAAISIDAVRRQMT
IMKSMGVNAFRTSHNPPSPQMIEVCEELGIVMVVEAFDCWRTGKTRYDYGRFFDEWCEKD
ATEMVLAARNSPAVVLWSIGNEIPDSTSTAGLAMADRIIGAIKAADDTRPLVIGSDKYRN
VPAKGSAADLMLAKLDGLGLNYNTAKSVDALHAAYPHLFLFESESSSETSTRGTYQEPEH
LNTGENHTPGKRATSSYDNNLASWTMSGEYGHKKDRDRKWFAGQFLWSGIDYIGEPTPYD
VFPVKASFFGAVDTAGFPKDMYHLFRSQWTSEPMVHLLPMSWNHQAGDTVEVWAYANVDT
VELFLNGKSLGTRTFDTKKTTDGRTYLETTEATGDDKTVTDGPHPGSYTSPNGSAGKLHL
VWKVPYEPGELKAVARRNGRAVATDVLRTAGAPHAVRLTPDRSALAADGRALCFVTAEIV
DARGVVVPDAEHLLSFAVSGGSLAGVDNGREESAERYQASTRTAFHGKALAIVRSGTKAG
TLKVTARSEGLRTATATVRTTPARSTATTPAAEFRPDHPAAPDSPSADASYSGRPDTLPA
AMLDGDPTTGWSNAFAKSATALLPAFSGARPEDWVSVTWARARAFDRVEVSFTVDATHTR
PASVEVQVGDGDRYTPVSGATVDWATGSDAPTVVTFDAARGARLRLVLTSAHPGAADGAV
RISRLEVPPS
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
atgacggtcactcgcagatcggttttgatcgccggtacggccgctccggcggccggcgca
ctcacgggcatcgggggcgcgccggccgtggcctcggccggcgccccgggccgccacacc
gtcgccctccgcgacggctggcgcttcgcgctggtcaaccccggcgggatcaccgacccg
accggcgcgtacgccgacgccgccgaccccggccacgacgactcgggttggcgcgaggtc
gccgtcccgcacgactggagcatcgagcagacgcccaccacgcagtacggcaccacgagc
ggcaccggcttcctgccgggcggcctcggctggtaccgcaccgccttcaccctgccgtcc
gccctcgccggcaagcggatctccgtcgagttcgacggcgtctacatggactcgtacgtc
tactgcaacggcacggaggtcggccgccacccctacggatacaccgggttcgcgttcgac
ctcaccgacctgctgcacaccgacggcaccaccgagaacgtcatcgccgtcaaggtgcag
aaccgactccccagcagccgctggtactcgggcagcggcatctaccgggaggcccggctc
gtggtcaccgagccggtgcatgtgcggcgctggggaacgtacgtcacgacgccggacatc
accgaggagcgggcggtcgtacgggtgcggacgaccgtcgtcgacgcgtcgggtgccggg
agcgaggtccaggtcgtctcccggatcgtcggccccgacggccgtaccgccgcccgtacg
acgtccacggtgaccgtcgctgaccagggcacccagacccatgaactcaccgtgaagaag
ccccagttgtgggacttcgcgcacccgcaccgctacaccctggagaccgaactccgggtc
ggcggcaagcggaccgacacccaccgcaccaccttcggcatccgccgtgtcaccgtcgac
ccggacgagggcttccatctcaacggcacccacgccaagatcaggggcgtcgatctgcac
cacgaccagggcgcgctcggggccgcgatcagcatcgacgccgtacgccgccagatgacc
atcatgaagtccatgggcgtcaacgccttccgcacctcccacaacccgccctcgccccag
atgatcgaggtctgcgaggaactgggcatcgtgatggtggtggaggccttcgactgctgg
cggaccggcaagacgaggtacgactacggccggttcttcgacgagtggtgcgagaaggac
gccaccgagatggtgctcgcggcccgtaactcgcccgccgtggtcctgtggtccatcggc
aacgagatccccgactcgacgtccaccgccgggctcgccatggccgaccgcatcatcggt
gcgatcaaggcggccgacgacacccgcccgctcgtcatcggctcggacaagtaccgcaac
gtcccggccaagggctcggcggccgacctcatgctcgccaagctcgacggactcggcctc
aactacaacaccgccaagtccgtggacgccctgcacgccgcctacccccacctcttcctc
ttcgagtcggagtcgtcgtcggagacctcgacccgtggcacgtaccaggagcccgagcac
ctcaacacgggcgagaaccacacgcccggcaagcgcgcgacctcctcgtacgacaacaac
ctcgcctcctggacgatgagcggcgagtacgggcacaagaaggaccgggaccggaagtgg
ttcgccgggcagttcctgtggtcgggcatcgactacatcggggagcccacgccgtacgac
gtcttcccggtgaaggcgtccttcttcggcgcggtcgacacggccggcttccccaaggac
atgtaccacctgttcaggagccagtggacgagcgagccgatggtccatctgctgcccatg
agctggaaccaccaggcgggcgacacggtcgaggtctgggcgtacgccaacgtcgacacc
gtcgaactgttcctcaacggaaagtccctgggcaccaggacgttcgacaccaagaagacc
accgacggccgtacgtacttggagacgacggaggccaccggcgacgacaagacggtcacc
gacggcccccaccccgggagttacaccagcccgaacggcagcgcgggcaagctccacctc
gtctggaaagtgccctacgaacccggggagctgaaggcggtggcccgccgcaacggcagg
gcggtcgccaccgacgtcctgcggaccgccggtgcgccccacgccgttcgcctcaccccc
gaccgctcggcactggccgccgacggccgggcgctgtgcttcgtgaccgcggagatcgtc
gacgcccgcggtgtggtggtgcccgacgccgagcacctgctctccttcgccgtgagcggc
ggctccctcgccggcgtcgacaacggccgggaggagagcgccgagcgctaccaggcaagc
acgcgaaccgccttccacggcaaggcacttgccatcgtgcgctccggtacgaaggcgggg
accctgaaggtgaccgcacgctcggaaggcctgcgtacggccaccgcgaccgtgcgcacc
acccccgcgcgctccacggcgaccacccccgccgccgagttccggcccgaccacccggcg
gcccccgactcgccctcggccgacgcgagttactccggccgccccgacaccctccccgcg
gccatgctcgacggcgacccgaccaccggctggtccaacgccttcgccaagtcggccacg
gctctgctgcccgccttcagtggcgcccggcccgaggactgggtgtcggtcacctgggcc
cgcgcccgcgccttcgaccgcgtcgaggtgtccttcaccgtcgacgcgacgcacacccgg
cccgcctccgtcgaggtccaggtcggggacggtgaccgctacacgcccgtgtcaggcgcc
accgtggactgggccaccgggtccgacgcgccgaccgtggtcaccttcgacgcggcacgc
ggcgcacggctgcgtctcgtcctgaccagcgcacaccccggcgccgccgacggagcggta
cggatcagccggctggaggtcccgcccagctga

DBGET integrated database retrieval system