KEGG   Streptomyces avermitilis: SAV_949Help
Entry
SAV_949           CDS       T00126                                 

Gene name
aveBV
Definition
dTDP-4-keto-6-deoxyhexose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sma  Streptomyces avermitilis
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:sma00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:sma00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1207922..1208599)
Genome map
AA seq 225 aa AA seqDB search
MTLGRPRRSSADRPAPPAGARATAAGVTVRRLVVEGAVEFTPTVFPDERGLFVTPYQEPV
LSEAVGHRFPTAQTCQSVSRRGVVRGVHFTATPPGQAKYVHCARGRALDFVVDLRTGSPT
FGQWDSVLLDQERFRSVYLPIGVGHAFVALEDDTAMVYLMSSGYVPQNEHALSPEDPDLA
LPLGHHLGRAPILSERDRRAPTLQQALRRGMLPEYRASRGLDEKL
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgacccttggccggcctcgccggagctccgccgaccggcccgccccgcccgcgggcgcc
cgggccaccgccgccggtgtcacggtccggaggctcgtcgtcgagggcgccgtcgaattc
accccgacggtcttccccgacgagcgcgggctcttcgtcaccccctaccaggaaccggtc
ctcagcgaggccgtcgggcaccggtttcccaccgcgcagacctgccagagcgtctcgcgc
cgcggcgtcgtccgcggcgtgcacttcaccgcgacaccacccggccaggccaagtacgtc
cactgcgcccggggacgggccctggacttcgtcgtcgacctgcgcaccggctcaccgact
ttcgggcagtgggactcggtcctcctcgaccaggagcgcttccgttccgtctacctgccg
atcggggtcgggcacgcgttcgtggcgctggaagacgacacggcgatggtgtacctgatg
tcgagcggctacgttccgcagaacgaacacgccctctcgcccgaggatccggacctcgcc
ctgcccctcggccaccacctcgggcgggcaccgatcctctccgagcgcgaccggcgcgcg
ccgactctccagcaggccctgcgacgcggcatgttgccggagtaccgcgcgagccgcggc
ctcgacgagaagctgtga

DBGET integrated database retrieval system