KEGG   Streptomyces avermitilis: SAV_949Help
Entry
SAV_949           CDS       T00126                                 

Gene name
aveBV
Definition
dTDP-4-keto-6-deoxyhexose 3,5-epimerase
Orthology
K16438  
epimerase EvaD
Organism
sma  Streptomyces avermitilis
Pathway
Biosynthesis of vancomycin group antibiotics
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SAV_949 (aveBV)
   01055 Biosynthesis of vancomycin group antibiotics
    SAV_949 (aveBV)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SAV_949 (aveBV)
Enzymes [BR:sma01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     SAV_949 (aveBV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1207922..1208599)
Genome map
AA seq 225 aa AA seqDB search
MTLGRPRRSSADRPAPPAGARATAAGVTVRRLVVEGAVEFTPTVFPDERGLFVTPYQEPV
LSEAVGHRFPTAQTCQSVSRRGVVRGVHFTATPPGQAKYVHCARGRALDFVVDLRTGSPT
FGQWDSVLLDQERFRSVYLPIGVGHAFVALEDDTAMVYLMSSGYVPQNEHALSPEDPDLA
LPLGHHLGRAPILSERDRRAPTLQQALRRGMLPEYRASRGLDEKL
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgacccttggccggcctcgccggagctccgccgaccggcccgccccgcccgcgggcgcc
cgggccaccgccgccggtgtcacggtccggaggctcgtcgtcgagggcgccgtcgaattc
accccgacggtcttccccgacgagcgcgggctcttcgtcaccccctaccaggaaccggtc
ctcagcgaggccgtcgggcaccggtttcccaccgcgcagacctgccagagcgtctcgcgc
cgcggcgtcgtccgcggcgtgcacttcaccgcgacaccacccggccaggccaagtacgtc
cactgcgcccggggacgggccctggacttcgtcgtcgacctgcgcaccggctcaccgact
ttcgggcagtgggactcggtcctcctcgaccaggagcgcttccgttccgtctacctgccg
atcggggtcgggcacgcgttcgtggcgctggaagacgacacggcgatggtgtacctgatg
tcgagcggctacgttccgcagaacgaacacgccctctcgcccgaggatccggacctcgcc
ctgcccctcggccaccacctcgggcgggcaccgatcctctccgagcgcgaccggcgcgcg
ccgactctccagcaggccctgcgacgcggcatgttgccggagtaccgcgcgagccgcggc
ctcgacgagaagctgtga

DBGET integrated database retrieval system