KEGG   Serratia marcescens subsp. marcescens Db11: SMDB11_1358Help
Entry
SMDB11_1358       CDS       T03985                                 

Gene name
cscA
Definition
(GenBank) sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
smac  Serratia marcescens subsp. marcescens Db11
Pathway
smac00052  Galactose metabolism
smac00500  Starch and sucrose metabolism
smac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smac00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SMDB11_1358 (cscA)
   00500 Starch and sucrose metabolism
    SMDB11_1358 (cscA)
Enzymes [BR:smac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     SMDB11_1358 (cscA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: CDG11933
Position
complement(1417692..1419134)
Genome map
AA seq 480 aa AA seqDB search
MNTALAQADHAVEALRAERRDDYYPQFHLAPPAGWINDPNGLICIDGVYHAFFQHHPYSE
HWGPMHWGHATSRDLIRWQHQPIALAPDAPYDKDGCFSGCAVDDNGVLTLIYTGHVWLGE
PGDDSQVREVQCLATSEDGIRFIKHGPVLAPPDGIQHFRDPKVWCENGEWWLVVGAKENG
LGQVRLYRSADLRAWRFDRVLAGAQTAHQGYMWECPDFFPLGEQHLLLFSPQGVAAQGYR
YRNRFQSGYLLGHWRPDGDFTVTQPFCELDAGHDFYAPQTFTAADGRRLLFAWMDMWESP
MPSKAHRWAGALTLPRELALAADGSVRMNPARELAALRREPHTFLAQTLTNQHLPLTNDV
QELTLTLRPADNDAERYGLAIGSAARLFVDNQAHRLVLERFHENPALCTCRSVPLPEGDI
LSLRIFIDRSSLEIFVNQGETCLTSRIYPTAGDRRLSLFAEGGRAQFESIEGWQLASIWG
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaacactgccttagctcaagccgaccatgcggtcgaagccctgcgtgcagagcgccga
gacgattactacccgcagttccatctcgcgccgcccgccggctggatcaacgatcccaac
ggcctgatctgtattgacggcgtctatcatgccttcttccagcatcacccctatagcgaa
cactggggccccatgcactgggggcacgcgaccagccgcgacctgatacgctggcagcat
cagcccatcgccctggcacccgatgcgccctatgacaaagacggttgcttttccggctgc
gccgtagatgacaacggtgtgctgacgctgatttacaccggccacgtgtggctgggcgaa
cccggtgacgacagccaggtgcgggaagtgcaatgtctggccaccagcgaagacggcata
cgcttcatcaaacacgggccggtactggccccgccggacggcattcagcattttcgcgat
ccgaaagtctggtgcgaaaacggcgaatggtggctggtggtcggcgccaaagagaacggc
ctgggccaggtgcgcctgtaccgctctgccgacctgcgcgcctggcgcttcgatcgggtg
ctggccggcgcgcaaacggcgcatcagggttatatgtgggaatgcccggatttcttcccg
ctgggggagcaacacctgctgctgttttcgccgcagggggtggcggcgcagggctaccgc
tatcgcaatcgcttccagagcggctatctgctcggccactggcggccggacggcgacttt
acggtgacccagcccttctgtgagctggatgccggccacgatttctatgcgccgcaaacc
ttcaccgccgccgacggccgtcggctgctgtttgcctggatggatatgtgggaatcccca
atgcccagcaaagcgcatcgctgggccggcgccctcaccctgccgcgcgaactggcgctg
gccgccgacggcagcgtccgcatgaacccggcgcgtgaactggcggcgctgcgccgagag
ccacacacgtttttggcgcagacgctgaccaatcagcatctgccgctgacgaacgacgtg
caggaactcaccctgacgttgaggccggccgacaacgacgccgagcgttacgggctggct
atcgggagtgcggcgcgcctgtttgtcgacaatcaggcgcaccgactggtgctggagcgt
tttcatgaaaaccccgccctgtgcacctgccgcagtgtgccgctgccggagggtgacatc
ctgtcgctgcggatctttatcgatcgctcatcgctggaaatcttcgtgaatcagggagag
acctgcctgaccagccgcatctatccgacggcgggcgatcgccgtctcagcctgttcgcc
gaaggcggccgggcgcagttcgagtcaatcgagggatggcagttggcgagcatctggggg
taa

DBGET integrated database retrieval system