KEGG   Serratia marcescens FGI94: D781_0055Help
Entry
D781_0055         CDS       T02433                                 

Definition
D-xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
smaf  Serratia marcescens FGI94
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:smaf00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:smaf00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(62606..63925)
Genome map
AA seq 439 aa AA seqDB search
MQSYFDQLEQVRYEGTGSNNPLAFRHYNPDEIVLGKRMADHLRFAACYWHTFCWNGADMF
GSGAFERPWQQAGDALELARRKADVAFEFFRKLNVPYYCFHDVDVAPEGGSLKEYLHNFA
VMTDVLAEKQQSSGVKLLWGTANCFTHPRYGAGAATNPDPEIFSWAAAQVYSAMNATQQL
GGENYVLWGGREGYETLLNTDLRQEREQIGRFMQMVVEHKHKIGFQGTLLIEPKPQEPTK
HQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHSFHHEIASAIALGIFGSVDANRG
DPQLGWDTDQFPNSVEENALVMFEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAM
DTMALALKVAARMIEDGQLDRQVAKRYAGWNGELGQQILQGKLSLDALAKYAEQHNLAPQ
HHSGHQEKYENLVNRYLFG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcttattttgatcagcttgaacaagtccgttacgaaggaaccggcagcaacaat
ccgctggcattccgccactacaacccagatgaaatcgtattaggcaaacgcatggccgac
catctgcgttttgccgcctgttactggcacactttctgctggaacggcgcggacatgttc
ggcagcggcgcgttcgagcgcccctggcagcaggcgggtgatgcgctggagctggcgcgg
cgcaaggcggacgtcgcctttgaattcttccgcaagctcaacgtgccgtactattgcttc
cacgacgttgacgtcgcgccggaaggcggatcgctgaaggagtatctgcacaacttcgcc
gtgatgaccgacgttctggcggaaaaacagcaaagcagcggcgtcaaactgctgtggggc
accgccaactgcttcacccacccgcgctatggcgccggcgcggctaccaacccggatccg
gaaatcttcagctgggcggcggcgcaggtatacagcgcgatgaacgccacccagcagctc
ggcggcgaaaactatgtgctgtggggcggccgcgaaggctatgaaacgctgctgaacacc
gacctgcgccaggagcgcgaacagattggccgctttatgcagatggtggtggagcacaaa
cacaaaatcggcttccagggcacgctgctgatcgagccgaaaccgcaggagccgaccaag
catcagtacgattacgacgtcgccacggtgtacggcttcctgaagcagttcgggctggaa
aaggagatcaaggtgaacatcgaggccaaccacgccacgctggccggccactcgttccac
catgaaatcgccagcgccatcgcgctcggcatcttcggctcggtggacgccaaccgcggc
gatccgcagcttggctgggataccgaccagttcccgaacagcgtcgaagagaacgcgctg
gtgatgtttgaaatcctcaaggccggcggctttaccaccggcggcctgaacttcgacgcc
aaagtgcgccgccagagcaccgacaaatatgacctgttctacggccatatcggcgcgatg
gacaccatggcgctggcgctgaaggtggcggccagaatgattgaggacgggcagctggat
cggcaggtcgccaaacgctatgccggctggaacggcgagctgggccaacaaattctgcag
ggaaaactgtcgctggacgcgctggccaagtacgctgaacagcataatctggcgccgcag
catcacagcggccaccaggagaaatatgagaatctggtaaaccgttatctgttcggctaa

DBGET integrated database retrieval system