KEGG   Serratia marcescens FGI94: D781_0119Help
Entry
D781_0119         CDS       T02433                                 

Definition
endoglucanase Y
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
smaf  Serratia marcescens FGI94
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    D781_0119
Enzymes [BR:smaf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     D781_0119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
127592..128701
Genome map
AA seq 369 aa AA seqDB search
MGVLLKYSLSLLLLCAFGAAAGCDWPAWQRYKQDYISAGGRVIDPSTPNRITTSEGQSYG
LFFALVAGDRPAFDRLLSWTEDNLAQGDLSARLPAWLWGENENKQWTVLDDNSASDSDLW
IAYSLLEAGRLWDSRRYQTLGTLLLARIAREEVADIPGLGPMLLPGKVGFVKDDGWRLNP
SYLPPQLLARFAALRGPWQAMQQSNQRLWLETAPHGFSPDWVVWRKTQGWRADAAKPNVG
SYDAIRVYLWAGMLADDDTLKAALVRRFQPMAQLTAQQGVPPEKTDTASGKTSGNGPVGF
SAALLPLLAHQPEALAAQRQKIIDHPPGNDAYFSASLTLFGQGWDEQRYRFNRQGELQPS
WDRQCATSE
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgtactgttgaaatactccctgagcctgctgctgctgtgcgcgttcggcgcggcg
gccggctgcgactggccggcctggcagcgctataagcaggactatatcagcgcgggcggc
cgggtgatcgacccgagcacgcccaaccgcatcaccacctcggaagggcagagctacggc
ctgttcttcgcgctggtggccggcgatcgtccggcctttgaccgcctgctgagctggacc
gaagacaatctggcgcagggcgatctcagcgcccggctgccggcctggctgtggggggag
aatgagaacaagcagtggacggtgctggatgacaattcggcgtccgattccgatctgtgg
atcgcctacagcctgctggaagccggccgcctgtgggacagccgccgctaccagacgctg
ggcaccctgctgcttgcgcgcattgcgcgcgaagaagtggcggatatccccgggctgggg
ccgatgctgctgcccggcaaggtcggctttgtgaaggacgacggctggcggctcaacccg
agctacctgccgccgcagctgctggcgcgctttgccgcgctgcgcgggccgtggcaggcg
atgcagcagtcgaatcagcggctgtggctggagaccgcgccgcacggcttctcgccggac
tgggtggtatggcgcaagacgcagggctggcgggccgacgcggccaagccgaacgtcggc
agctatgacgccatccgcgtctatctgtgggcgggcatgctggcggatgacgatacgctc
aaagccgcgctggtgcggcgtttccagccgatggcgcagctgaccgcgcagcagggcgtg
ccgccggaaaaaaccgataccgccagcggtaaaaccagcggcaacggcccggtgggtttt
tccgccgccctgctgccgctgctggcgcaccagcctgaggcgctggcggcgcagcgacag
aaaattatcgaccacccgccgggcaacgacgcctacttcagcgcgtcgctgacgctgttc
ggccagggctgggatgaacaacgttaccgttttaaccgtcagggtgaactgcaaccttcc
tgggatcgccaatgcgcaacttcagaataa

DBGET integrated database retrieval system