KEGG   Serratia marcescens FGI94: D781_0119Help
Entry
D781_0119         CDS       T02433                                 

Definition
(GenBank) endoglucanase Y
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
smaf  Serratia marcescens FGI94
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
127592..128701
Genome map
AA seq 369 aa AA seqDB search
MGVLLKYSLSLLLLCAFGAAAGCDWPAWQRYKQDYISAGGRVIDPSTPNRITTSEGQSYG
LFFALVAGDRPAFDRLLSWTEDNLAQGDLSARLPAWLWGENENKQWTVLDDNSASDSDLW
IAYSLLEAGRLWDSRRYQTLGTLLLARIAREEVADIPGLGPMLLPGKVGFVKDDGWRLNP
SYLPPQLLARFAALRGPWQAMQQSNQRLWLETAPHGFSPDWVVWRKTQGWRADAAKPNVG
SYDAIRVYLWAGMLADDDTLKAALVRRFQPMAQLTAQQGVPPEKTDTASGKTSGNGPVGF
SAALLPLLAHQPEALAAQRQKIIDHPPGNDAYFSASLTLFGQGWDEQRYRFNRQGELQPS
WDRQCATSE
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgtactgttgaaatactccctgagcctgctgctgctgtgcgcgttcggcgcggcg
gccggctgcgactggccggcctggcagcgctataagcaggactatatcagcgcgggcggc
cgggtgatcgacccgagcacgcccaaccgcatcaccacctcggaagggcagagctacggc
ctgttcttcgcgctggtggccggcgatcgtccggcctttgaccgcctgctgagctggacc
gaagacaatctggcgcagggcgatctcagcgcccggctgccggcctggctgtggggggag
aatgagaacaagcagtggacggtgctggatgacaattcggcgtccgattccgatctgtgg
atcgcctacagcctgctggaagccggccgcctgtgggacagccgccgctaccagacgctg
ggcaccctgctgcttgcgcgcattgcgcgcgaagaagtggcggatatccccgggctgggg
ccgatgctgctgcccggcaaggtcggctttgtgaaggacgacggctggcggctcaacccg
agctacctgccgccgcagctgctggcgcgctttgccgcgctgcgcgggccgtggcaggcg
atgcagcagtcgaatcagcggctgtggctggagaccgcgccgcacggcttctcgccggac
tgggtggtatggcgcaagacgcagggctggcgggccgacgcggccaagccgaacgtcggc
agctatgacgccatccgcgtctatctgtgggcgggcatgctggcggatgacgatacgctc
aaagccgcgctggtgcggcgtttccagccgatggcgcagctgaccgcgcagcagggcgtg
ccgccggaaaaaaccgataccgccagcggtaaaaccagcggcaacggcccggtgggtttt
tccgccgccctgctgccgctgctggcgcaccagcctgaggcgctggcggcgcagcgacag
aaaattatcgaccacccgccgggcaacgacgcctacttcagcgcgtcgctgacgctgttc
ggccagggctgggatgaacaacgttaccgttttaaccgtcagggtgaactgcaaccttcc
tgggatcgccaatgcgcaacttcagaataa

DBGET integrated database retrieval system