KEGG   Serratia marcescens FGI94: D781_0166Help
Entry
D781_0166         CDS       T02433                                 

Definition
outer membrane phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
smaf  Serratia marcescens FGI94
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    D781_0166
   00565 Ether lipid metabolism
    D781_0166
   00590 Arachidonic acid metabolism
    D781_0166
   00591 Linoleic acid metabolism
    D781_0166
   00592 alpha-Linolenic acid metabolism
    D781_0166
Enzymes [BR:smaf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     D781_0166
    3.1.1.32  phospholipase A1
     D781_0166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
179720..180598
Genome map
AA seq 292 aa AA seqDB search
MRILSGAVMATLLAPALVQAEEAKQQEIHDKPAVNGSIIANMLQSHDNPFTLYPYEPNYI
LYSYTSDLNKEAIDSYSWADHARKDEVKFQLSLAFPLWRGIVGENSVLGASYTQRSWWQL
SNSGQSSPFRETNYEPQIFLGWATDYTFAGWTLRDVEVGLNHQSNGRSEPTSRSWNRAYA
RLMAQNGNWQVDVKPWLRFSESASSDDNPDITKYMGYYRLKVGYTWGESVFSVDGHYNWN
SGFGGAELGWSYPITKHVRFYTQVFSGYGESMIDYNFRQTRVGVGVMLNDIM
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattctgtcaggggccgtgatggcaacgctgttagccccggcgctggttcaggcc
gaagaagcgaaacaacaagaaatacatgataaaccggcggttaacggcagcattatcgcc
aatatgctgcaatcccacgataacccgtttacgctctacccgtacgaacccaactacata
ctgtatagctacaccagcgatctcaataaagaggcgatcgacagctacagctgggcggat
cacgcgcgcaaagacgaggtgaaattccagctcagcctggccttcccactgtggcgcggc
attgttggtgaaaactcggtgcttggcgcgtcctatactcaacgctcttggtggcagctg
tccaacagcggccagtcctcgccgttccgcgaaaccaactacgagccgcagattttcctc
ggctgggcgacggattacacctttgccggctggacgctgcgcgacgttgaggtggggctt
aaccaccagtcgaacggccgctcggagccgacgtcgcgcagttggaaccgcgcctacgcg
cgcctgatggcgcagaacggcaactggcaggtagacgtcaaaccctggctgcgtttctcc
gaaagcgccagcagcgacgacaacccggatatcaccaagtacatgggctactaccgcctg
aaagtcggttatacctggggcgagagcgtattcagcgtagacggccactataactggaac
agcggtttcggcggggcggagctgggctggagctatccgatcaccaagcacgtgcgtttc
tatacccaggtattcagcggctatggcgaatcgatgattgattacaacttccggcagaca
cgcgtcggcgttggtgtcatgctgaacgatattatgtaa

DBGET integrated database retrieval system