KEGG   Serratia marcescens FGI94: D781_0169Help
Entry
D781_0169         CDS       T02433                                 

Definition
(GenBank) lysophospholipase
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
smaf  Serratia marcescens FGI94
Pathway
smaf00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    D781_0169
Enzymes [BR:smaf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     D781_0169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 LIDHydrolase DLH
Motif
Other DBs
NCBI-ProteinID: AGB80557
UniProt: L0MB86
Position
183181..184221
Genome map
AA seq 346 aa AA seqDB search
MTASILSPDEWLTRETQFAAFATGPLLDFWRTRQEGEFSGVDEVPIRYVRFSAPQHQRVV
VISPGRIESYVKYPEVAYDLFQCGYDVMIIDHRGQGRSGRLLADSHRGHVVNFADYVEDF
TRFYQQAVQPLGYRQHFALAHSMGGAILAQFLARQPQAFAAAALCAPMFGIYLPMPDWMA
HRILNWAEKRPNVRDYYAVGTGQWRPLPYMVNVLTHSRERYRRAVRYYADYPELQVGGPT
YHWVRESIQAGQQAIAEAAEIATPILLLQAGEERVVDNRSHQAFCQALSDAGHPCEGEKP
RVIQGARHEILFERDAMRAEALNAILRFYAQHAFSGADAADNSIRG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgtctatactcagccccgatgaatggctcacgcgtgaaacccagtttgcggcc
tttgccaccggcccgctgctggatttctggcgcacgcgccaggagggtgagttcagcggc
gtcgatgaggtgccgattcgctatgtgcgctttagcgcgccgcagcatcagcgggtggtg
gtgatcagccccggccgcatcgaaagctatgtgaagtacccggaagtcgcctacgatctg
tttcagtgcggctacgacgtgatgattatcgaccaccgcgggcaggggcgctccgggcgt
ctgctggcggacagccaccgtggccacgtggtgaactttgccgattacgtcgaagatttt
acgcgcttttatcagcaggcggtgcagccgctgggctatcgccagcatttcgccctggcg
cactcgatgggcggtgcgattctggcgcagttcctcgcccgccagccgcaggcgttcgcc
gccgctgcgctgtgcgcgccgatgttcggcatctacctgccgatgcccgactggatggcg
caccgcatcctgaactgggcggagaaacggccgaacgtgcgcgattactatgcggtgggc
accggccagtggcggccgctgccgtatatggtcaacgtgctgacccacagccgcgagcgc
taccggcgcgcggtgcgttactatgccgactacccggagctgcaggtgggcgggccgacc
taccactgggtgcgggaaagtattcaggccgggcaacaggcgattgccgaggccgcagag
atcgctacgccaatcttgttattgcaggccggtgaggaacgggtggtcgacaaccgttcg
caccaggctttttgtcaggcactgtcagacgcgggacacccttgcgaaggggaaaaaccg
cgggttatccagggcgcacgccatgagatcctgtttgagcgggacgctatgcgcgccgaa
gcactaaacgcaatcctgcgtttttatgctcaacacgctttcagcggcgctgatgccgcc
gacaactccattagaggttga

DBGET integrated database retrieval system