KEGG   Serratia marcescens FGI94: D781_0184Help
Entry
D781_0184         CDS       T02433                                 

Definition
Matrixin/Peptidase M10 serralysin C terminal
Organism
smaf  Serratia marcescens FGI94
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
200966..202459
Genome map
AA seq 497 aa AA seqDB search
MFIYLIVNDQIMRGIEPMQSKKKAIETNESSLAAAKSGYDAVNDLLHYHQRGNGIQVNGK
DSFSTEDAGLYITRTNQTWNGKGVFDTPVKLTFSFPDYQFNSANGGGDRGLSKFSTEQQQ
QAKLSLQSWSDVANITFTEVSGTQKANITFGNYSQDQYGQTDYDTQAYAWLPGSGSVSGQ
SWYNINQSNIQHPASEDYGRQTFTHEIGHALGLSHPGDYNAGQGNPSYRDASYAEDTRMF
SLMSYWSESNTGGDNGGHYAAGPLLDDISAIQHLYGANMSTRTGDTVYGFNSNTDRDFFS
TSSNAEKVIFSVWDAGGNDTFDFSGYSADQRINLNEKSFSDVGGLKGNVSIAAGVTIENA
IGGSGNDVLVGNQADNVLKGGAGNDILFGGGGADELWGGAGSDTFVFSAVSDSTPGAPDW
IRDFQKGIDKIDLSYFNKGGEGVHFVDHFSGAAGEALLTYDAANNVSDLAVDFGGHSTPD
FLVKIVGQADVATDFIV
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgtttatctatttgatcgttaacgatcaaataatgcgtggaatcgaaccaatgcaatcg
aagaaaaaagcgatagaaacaaatgaatccagcctggccgctgccaaatccggttatgat
gcggtgaatgacttactgcattatcaccaacgcggtaatgggattcaagttaatggcaag
gactcattttctacggaagatgccgggttatatattacccgtactaaccaaacctggaat
ggaaaaggcgtatttgatacgccggtaaaattgacgttctctttccccgactatcagttc
aattccgccaacggcggcggcgatcgcgggttaagcaagttcagcaccgaacagcagcag
caggccaaactgtcgctgcagtcctggtctgacgtcgccaatatcaccttcaccgaggtg
tccggcacgcaaaaagccaatatcaccttcggcaactacagccaggatcagtacggccag
accgactatgacacgcaggcgtatgcttggctgccgggctccggcagcgtctccggccaa
agctggtacaacatcaaccagtccaatattcagcacccggcttctgaagactacggtcgc
cagacctttacccatgaaatcggccatgccctgggcctgagccaccccggtgattacaac
gccggccagggtaacccttcctatcgcgacgccagctatgcggaagatacccgcatgttc
agcctgatgagctactggagtgaaagcaacaccggcggcgacaacggcggtcattatgcc
gccggcccgctgctggacgacatttcggcgatccagcacctgtacggcgccaacatgagc
acccgcaccggcgatacggtatacggctttaactccaataccgaccgcgacttcttcagc
accagcagcaacgcggaaaaagtgatcttctccgtgtgggatgccggtggcaacgatacc
tttgatttctccggctatagcgccgaccagcgtatcaacctgaacgagaagtcattctcc
gacgtcggcggcctgaagggcaacgtgtcgattgcggcgggtgtgaccattgagaacgcc
atcggcggttccggcaatgacgtgctggtcggcaatcaggcggataacgtgctcaagggc
ggcgcgggcaacgacatcctgttcggcggcggcggcgccgatgaactgtggggcggcgcc
ggcagcgacacctttgtgttctccgccgtcagcgactccacgccgggcgcgccggactgg
atccgtgacttccagaagggtatcgataaaatcgatctgtcatactttaacaaaggcggc
gagggggttcattttgtcgaccacttcagcggcgcggcgggcgaagccctgttaacctat
gatgccgccaacaacgtcagcgatctggcggtggacttcggcggacatagcacgccggac
ttcctggtgaaaattgtcggacaggcggacgtcgccaccgactttatcgtctag

DBGET integrated database retrieval system