KEGG   Serratia marcescens FGI94: D781_0184Help
Entry
D781_0184         CDS       T02433                                 

Definition
Matrixin/Peptidase M10 serralysin C terminal
Orthology
K01406  
serralysin [EC:3.4.24.40]
Organism
smaf  Serratia marcescens FGI94
Pathway
Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Human Diseases
  Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    D781_0184
Enzymes [BR:smaf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.40  serralysin
     D781_0184
Peptidases [BR:smaf01002]
 Metallo Peptidases
  Family M10
   D781_0184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
200966..202459
Genome map
AA seq 497 aa AA seqDB search
MFIYLIVNDQIMRGIEPMQSKKKAIETNESSLAAAKSGYDAVNDLLHYHQRGNGIQVNGK
DSFSTEDAGLYITRTNQTWNGKGVFDTPVKLTFSFPDYQFNSANGGGDRGLSKFSTEQQQ
QAKLSLQSWSDVANITFTEVSGTQKANITFGNYSQDQYGQTDYDTQAYAWLPGSGSVSGQ
SWYNINQSNIQHPASEDYGRQTFTHEIGHALGLSHPGDYNAGQGNPSYRDASYAEDTRMF
SLMSYWSESNTGGDNGGHYAAGPLLDDISAIQHLYGANMSTRTGDTVYGFNSNTDRDFFS
TSSNAEKVIFSVWDAGGNDTFDFSGYSADQRINLNEKSFSDVGGLKGNVSIAAGVTIENA
IGGSGNDVLVGNQADNVLKGGAGNDILFGGGGADELWGGAGSDTFVFSAVSDSTPGAPDW
IRDFQKGIDKIDLSYFNKGGEGVHFVDHFSGAAGEALLTYDAANNVSDLAVDFGGHSTPD
FLVKIVGQADVATDFIV
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgtttatctatttgatcgttaacgatcaaataatgcgtggaatcgaaccaatgcaatcg
aagaaaaaagcgatagaaacaaatgaatccagcctggccgctgccaaatccggttatgat
gcggtgaatgacttactgcattatcaccaacgcggtaatgggattcaagttaatggcaag
gactcattttctacggaagatgccgggttatatattacccgtactaaccaaacctggaat
ggaaaaggcgtatttgatacgccggtaaaattgacgttctctttccccgactatcagttc
aattccgccaacggcggcggcgatcgcgggttaagcaagttcagcaccgaacagcagcag
caggccaaactgtcgctgcagtcctggtctgacgtcgccaatatcaccttcaccgaggtg
tccggcacgcaaaaagccaatatcaccttcggcaactacagccaggatcagtacggccag
accgactatgacacgcaggcgtatgcttggctgccgggctccggcagcgtctccggccaa
agctggtacaacatcaaccagtccaatattcagcacccggcttctgaagactacggtcgc
cagacctttacccatgaaatcggccatgccctgggcctgagccaccccggtgattacaac
gccggccagggtaacccttcctatcgcgacgccagctatgcggaagatacccgcatgttc
agcctgatgagctactggagtgaaagcaacaccggcggcgacaacggcggtcattatgcc
gccggcccgctgctggacgacatttcggcgatccagcacctgtacggcgccaacatgagc
acccgcaccggcgatacggtatacggctttaactccaataccgaccgcgacttcttcagc
accagcagcaacgcggaaaaagtgatcttctccgtgtgggatgccggtggcaacgatacc
tttgatttctccggctatagcgccgaccagcgtatcaacctgaacgagaagtcattctcc
gacgtcggcggcctgaagggcaacgtgtcgattgcggcgggtgtgaccattgagaacgcc
atcggcggttccggcaatgacgtgctggtcggcaatcaggcggataacgtgctcaagggc
ggcgcgggcaacgacatcctgttcggcggcggcggcgccgatgaactgtggggcggcgcc
ggcagcgacacctttgtgttctccgccgtcagcgactccacgccgggcgcgccggactgg
atccgtgacttccagaagggtatcgataaaatcgatctgtcatactttaacaaaggcggc
gagggggttcattttgtcgaccacttcagcggcgcggcgggcgaagccctgttaacctat
gatgccgccaacaacgtcagcgatctggcggtggacttcggcggacatagcacgccggac
ttcctggtgaaaattgtcggacaggcggacgtcgccaccgactttatcgtctag

DBGET integrated database retrieval system