KEGG   Serratia marcescens FGI94: D781_0228Help
Entry
D781_0228         CDS       T02433                                 

Definition
(GenBank) fatty oxidation complex, alpha subunit FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
smaf  Serratia marcescens FGI94
Pathway
smaf00071  Fatty acid degradation
smaf00280  Valine, leucine and isoleucine degradation
smaf00281  Geraniol degradation
smaf00310  Lysine degradation
smaf00362  Benzoate degradation
smaf00380  Tryptophan metabolism
smaf00410  beta-Alanine metabolism
smaf00640  Propanoate metabolism
smaf00650  Butanoate metabolism
smaf00903  Limonene and pinene degradation
smaf00930  Caprolactam degradation
smaf01040  Biosynthesis of unsaturated fatty acids
smaf01100  Metabolic pathways
smaf01110  Biosynthesis of secondary metabolites
smaf01120  Microbial metabolism in diverse environments
smaf01130  Biosynthesis of antibiotics
smaf01200  Carbon metabolism
smaf01212  Fatty acid metabolism
Module
smaf_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    D781_0228
   00650 Butanoate metabolism
    D781_0228
  Lipid metabolism
   00071 Fatty acid degradation
    D781_0228
   01040 Biosynthesis of unsaturated fatty acids
    D781_0228
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    D781_0228
   00310 Lysine degradation
    D781_0228
   00380 Tryptophan metabolism
    D781_0228
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    D781_0228
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    D781_0228
   00281 Geraniol degradation
    D781_0228
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    D781_0228
   00930 Caprolactam degradation
    D781_0228
Enzymes [BR:smaf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     D781_0228
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     D781_0228
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     D781_0228
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     D781_0228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AGB80615
UniProt: L0MCX2
Position
complement(244321..246510)
Genome map
AA seq 729 aa AA seqDB search
MLYQGETLQLHELENGIAELVFDAPGSVNKLDTRTVAALGEALDVLEKHAGLKGLLLRSN
KNAFIVGADITEFLSLFAAPAEKLQHWLAYANSIFNRLEDLPVPTISAINGYALGGGCEC
VLATDFRVATPDARIGLPETKLGIMPGFGGSVRLPRLLGNDSALEIIAAGKDIGAKEALK
VGLVDAVVAPEKLADAARQMLQQAIDGQLDWRASRQPKLEPLKLSPIEAAMSFTTAKGMV
LQTAGKHYPAPMTAVKTIEAAAKLGRDEALKLETASFVPLARSNEARALVGIFLNDQFVK
GQAKKLAKDHAAPKQAAVLGAGIMGGGIAYQSALKGVPVLMKDISEKSLTLGMGEAAKLL
NKQLERGKLDGMKMAGVLATIQPTLDYAGIERAQVIVEAVVENPKVKAAVLSEVESLIGE
ETVLASNTSTIPINELAKSLQRPQNFCGMHFFNPVHRMPLVEIIRGERTSDDTIAAVVAY
ASRMGKTPIVVNDCPGFFVNRVLFPYFAGFSLLLRDGADFRQVDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPERMGKDYRDAVDVMFDNQRFGQKNQLGFYRYSQDNKGRP
RKENDEQTDTLLAEVSQPRQNISAEETIARMMIPMINEVVRCLEEGIIASPAEADMALVY
GIGFPPFHGGVFRYLDTMGTAHYVEMAQRYAHLGALYQVPAGLRAKAERNESYYPVTAPI
ADVSTGQPA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctaccaaggcgaaacattacaactgcacgagctcgagaacggtatcgccgagctg
gtgtttgatgccccaggctcggtcaacaagctggatacccgtaccgttgccgcgctgggc
gaagcgctcgacgtcctggagaaacatgccgggctgaaagggctgctgctgcgttccaac
aaaaacgcatttatcgtcggtgccgatatcaccgaattcctgtcactgttcgccgccccg
gcggaaaaactgcagcattggctggcctacgccaattctattttcaaccgcctggaagat
ttaccggtgccgaccatttccgcgattaacggctatgcgctgggcggcggttgcgaatgc
gtgctggcgacagacttccgcgtggcaacgccggatgcgcgcatcggcctgccggaaacc
aaactcggcatcatgccgggcttcggtggctcagtacgtctgccgcgtctgctcggcaac
gacagcgcgctggaaattattgccgccggtaaagacatcggcgctaaagaggcgctgaaa
gtcggcctggtcgatgcggtcgtcgcgccggaaaaactggcggacgctgcgcggcagatg
ttgcagcaggccatcgacggacaattggactggcgcgccagccgccagccgaagctggag
ccgctgaagctcagcccgattgaagcagcgatgagctttaccaccgccaaaggcatggtg
ctgcaaaccgccggcaaacactacccggcgccgatgaccgcggtgaaaaccattgaagcc
gccgccaaactggggcgcgatgaagccctgaagctggagaccgccagctttgtgccgctg
gcgcgttccaatgaagcgcgggccttggtcggcatcttcctcaacgatcagtttgtgaaa
ggtcaggcgaaaaaactggcgaaagaccatgccgcgccgaagcaggccgcagtgctgggc
gccggtattatgggcggcggcatcgcctatcagtccgcattaaaaggcgtgccggtgctg
atgaaggatatcagtgagaaatcgctgacgctcggcatgggcgaagccgccaaactgctg
aacaaacagctggagcgcggcaagctcgacggcatgaaaatggccggcgtgctggcaacc
attcagccaacgctggactacgccgggatcgaacgcgcccaggtgatcgtcgaagcggtg
gtggagaatccgaaggtcaaagccgcggtgctgagcgaagtggaaagcctgatcggcgaa
gaaacggtgctggcctccaacacctcgaccattccgatcaatgagctggcaaaatcgctg
cagcgcccgcaaaacttttgcggtatgcacttctttaacccggtgcaccgtatgccgctg
gtagaaattatccgcggcgagcgcaccagcgacgacaccattgctgccgtagtggcctac
gcgtcacgcatggggaaaacgccgatcgtggtcaatgactgcccgggcttcttcgtcaac
cgcgtgctgttcccttactttgccggcttcagcctgctgctgcgggacggcgccgatttc
cgccaggtcgataaagtgatggaaaaacagttcggctggccaatgggtccggcttatctg
ctggacgtggtcggcatcgataccgcacatcatgcccaggcggtgatggccgccggcttc
cctgaacgcatgggcaaagattaccgtgacgcggtcgacgtgatgttcgacaaccagcgt
ttcggccagaaaaatcagctggggttctaccgctatagccaggataacaaaggcagaccg
cgtaaagagaacgatgaacaaaccgatacgctgctggcggaagtcagccagccgcggcaa
aacatcagcgccgaagaaaccatcgcgcgcatgatgattccgatgattaacgaagtggtg
cgctgtctggaggaaggcatcatcgccagcccggcggaagccgatatggcactggtttac
ggcatcggtttcccgccgttccacggcggcgtattccgctacctggataccatgggcacg
gcccattacgttgaaatggcgcagcgttacgcacatctgggcgcgctgtaccaggtcccg
gccggcctgcgcgccaaagccgaacgtaatgaaagctactacccggtgacggcgccgatc
gcggatgtctccactggccaaccggcatga

DBGET integrated database retrieval system