KEGG   Serratia marcescens FGI94: D781_0456Help
Entry
D781_0456         CDS       T02433                                 

Definition
N-acetyl-beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
smaf  Serratia marcescens FGI94
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    D781_0456
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    D781_0456
Enzymes [BR:smaf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     D781_0456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
489868..492258
Genome map
AA seq 796 aa AA seqDB search
MHKPLRYTLLATSLLCPLGTLAQPAGKLPLMPWPQQVEIAQPQGKLVLTPRINLQVEGDN
LGDAPARWRQRLELQTGWTLVPGTTQQASTITVKIQRQVSAQPLPDSDESYRLSVTPQGA
TLNAATRFGALRGMETLLQLVQTDSHNTFLPLVSIHDKPRFAWRGVLLDSARHFLPVSDI
LRQLDGMAAAKLNVFHWHLTDDQGWRFASARYPKLQQLASDGQFYTREQMQQVVAYAAAR
GIRVVPEVDLPGHASSIAVAYPELISAPGPYQMEREWGVHAPTLDPGNEQVYQFIDAIVG
ELTTIFPDPYLHIGGDEVDPSQWQQSKTLQALMREHQLADAHALQAWFNQRLEKILERHQ
RRMVGWDEIYHPSLPRTILIQSWQGPDSLGASAQDGYQGILSTGFYLDQPQSTAYHYRNE
VLPQPLGVETQIAAGEQAQSWRFEIPRLKGSAVAGSFTLIKGRQGWRGFIDFDGKTRRAL
HDIIWRTPQQVSFRLDTWMGDTRPVVTLQGDKLSGYTLLGNVRYPTSGSRLDAAPEGKMP
VVPGVKQQANILGGEAALWAENVRAPLLDLKLWPRAFAVAERLWSAQDVTDENNMYRRLA
AVDAWSVVSVGLQQHAETAREFTRLANSVEIMPLQTLAEALEPAQYYTRQHLKFRAGNYH
QFEPLNRLVDALPPESRAVREMHQQVEALLRDRDNRVAAEALRSRLLRWQQNATPVKRLI
GGNVLMKELAPVAQDVNALAELGLTLLDRWRQGKPLGKREAEQIQQQLDAAAQVRDELTI
AAVYPLETLLRGLTVR
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgcataaaccgcttcgttatacattgcttgcgacgtcgttactctgccctctgggtacg
ctggcgcaaccggcgggcaagctgccgctaatgccgtggccgcagcaggtggagatcgcc
cagccgcagggcaaactggtgctgacgcctcgcatcaatctacaggtggagggcgataat
ctgggggacgcgccggcgcgctggcgccagcgtcttgaactacagaccggctggacgctg
gtgccgggtacgacgcagcaggccagcaccattacggtgaagatccagcgccaggtctcg
gcccagccgctgccggacagcgatgaaagttaccggctgtcggtgacgccgcagggggcg
acgctgaacgccgccacccgcttcggcgcgctgcgcggcatggaaaccctgctgcagctg
gtgcagaccgatagtcacaacaccttcctgccgctggtcagcatccatgacaaaccgcgc
tttgcctggcgtggcgtgctgctggattcggcgcgccatttcctgccggtcagcgatatt
ctgcgccagctggacggcatggcggcggccaagctaaacgtcttccactggcatttgacc
gacgatcagggctggcgcttcgcctccgcgcgctatcccaagctgcagcaactggccagc
gacggccagttctatacccgcgagcagatgcagcaggtggtggcctacgccgcggcgcgc
ggcatccgcgtggtgccggaagtcgatctgccgggtcatgcctccagcatcgcggtggcc
tacccggagctgatcagcgcgccggggccgtaccagatggagcgcgagtggggcgtgcat
gcgccgacgctggatcccggcaacgagcaggtttatcagtttattgacgcgatcgtcggc
gagctgacgacgatcttccccgatccctatctacacatcggcggcgatgaggtcgatccc
agccagtggcagcagtcgaaaacgctgcaggcgctgatgcgtgagcatcagctggcggac
gcccatgcgctgcaggcctggtttaatcagcggctggaaaagatcctcgagcgccatcag
cgacgcatggtgggctgggacgagatctaccacccgtcgttgccgcgcaccatcctgatc
cagtcctggcaggggccggactcgctgggggccagcgcgcaggacggttatcagggcatt
ctgtccaccggcttctatctcgatcagccgcagagcaccgcctaccactatcgcaatgaa
gtgctgccgcagccgctcggggttgagactcagatcgcggccggcgagcaggcgcaaagc
tggcgttttgagatcccgcggctgaagggcagcgcggtggcgggcagctttaccctgatt
aagggccggcagggctggcgcggctttatcgacttcgacggcaaaacccgccgcgcgctg
cacgatattatctggcgtacgccgcagcaggtgagcttccggctggatacctggatgggt
gacacccgtccggtcgtcaccctgcagggggacaagctcagcggctatacgttgctgggc
aacgtgcgttaccccaccagcggcagccggctggatgcggcaccggagggcaaaatgccg
gtggtgccgggcgtcaagcagcaggccaatattctcggcggcgaggcggcgctgtgggcg
gagaacgtgcgtgcgccgctgctggatctgaagctgtggccgcgcgcctttgcggtagcg
gagcggctgtggtcggcgcaggacgttaccgatgagaacaacatgtaccgccgtctggcg
gcggtggacgcctggtcggtggtgtccgtcggtctgcagcagcatgcggaaaccgcgcgg
gagttcacccgcctggccaacagcgtcgagattatgccgctgcaaacgctggccgaagcg
ctggagccggcgcagtattacacgcgtcagcatctcaagttccgggcgggcaactaccat
cagtttgagccgctgaaccggctggtggacgcgctgccgccggagagtcgggcggtgcgc
gagatgcatcagcaggtggaggcgctgctgcgcgatcgcgataaccgcgtggccgccgag
gcgctgcgcagccgcctgctgcgctggcagcagaatgcgacgccggtgaagcggctgatt
ggcggcaacgtgctgatgaaagagttggcgccggtggcgcaggacgtcaacgcgctggcg
gagctggggctgacgttgctggatcgctggcggcagggcaagccgctgggcaagcgtgaa
gcggagcagatccagcagcagctggacgcggcggcgcaggtgcgcgatgagttgaccatc
gccgcggtctatccgctggaaaccctgctgcgcggcctgacggtgcgctga

DBGET integrated database retrieval system