KEGG   Serratia marcescens FGI94: D781_0612Help
Entry
D781_0612         CDS       T02433                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
smaf  Serratia marcescens FGI94
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    D781_0612
Enzymes [BR:smaf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     D781_0612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
653898..655220
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGQPLSEEEIRFFINGIRDNVVSEGQIAALAMTIYFHDMTMPERVALT
MAMRDSGTVLDWKSLDLNGPVVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFNIFPDDAAFRKIIKEVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITGSILAKKLAEGLDALVMDVKVGSGAFMPTYALSEDLAQAIVGVANGAGCKTTALLT
DMNQVLASSAGNAVEVREAVRFLTGEYRNPRLLEVTMALCVEMLLSGGLAQDDADARAKL
QAVLDNGKAAEVFGRMVAAQQGPSDFVERYDSYLPTATLSKPVYAEREGIVSAMDTRELG
MAVVTLGGGRRRATDSIDYSVGLTDMARLGDRIDAKQPLAVIHANDEESWQQAADAVRGA
MTLSDQAPEATPVVYKRITQ
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttgttcctggcacaagaaatcattcgtaagaaacgtgacggtcagccgctgagcgaagag
gaaatccgcttctttattaacggcatccgcgataacgtcgtctccgaagggcagatcgcc
gcgctggcgatgaccatctattttcatgatatgaccatgccggagcgcgtggcgctgacc
atggcgatgcgcgattccggcacggtactggactggaagagcctggatctcaacggtccg
gtggtggacaagcactccaccggcggcgtgggcgacgtaacctcgctgatgctcggcccg
atggtggcggcctgcggcggctacgtgccgatgatctccggccgcggtctgggccacacc
ggcggcaccctggataaactggaagccattcccggctttaatatcttcccggatgacgcc
gctttccgtaaaatcatcaaagaggtcggcgttgcgattatcggccagaccagttcgctg
gccccggcggacaaacgcttctatgccacgcgcgatattaccgccaccgtggactccatt
ccgctgatcaccggttcgatcctggccaagaaactggcggaagggttggatgccttggtg
atggacgtgaaagtaggctccggcgcctttatgccgacctatgcgctgtcggaagatttg
gcgcaggccatcgttggcgtcgccaacggcgccggctgcaaaaccacggcgctgctgacc
gatatgaaccaggtgctggcgtccagcgccggcaacgcggtggaagtgcgcgaagcggta
cgcttcctgaccggtgaataccgcaacccgcgtctgctggaagtcaccatggcgctgtgc
gtggaaatgctgctctccggcggcctggcgcaggatgacgccgatgcgcgcgccaaactg
caggcggtgctggataacggcaaggcggcggaagtcttcggccgcatggtggcggcgcag
cagggtccgagcgactttgttgagcgttacgacagctacctgccgacggcgacgctgagc
aagccggtgtacgccgagcgtgaaggcatcgtcagcgccatggatacccgtgaactgggc
atggcggtggtgacccttggcggcggccgtcgccgcgccaccgacagcatcgactacagc
gtcgggctgaccgatatggcgcgcctgggcgaccgcattgacgccaaacagccgctggcg
gtgatccacgccaacgacgaggagagctggcagcaggcggccgacgcggtgcgcggcgcg
atgacgctgagcgaccaggcgccggaagcgacgccggtggtgtataaacgcatcacccag
taa

DBGET integrated database retrieval system