KEGG   Serratia marcescens FGI94: D781_0635Help
Entry
D781_0635         CDS       T02433                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
smaf  Serratia marcescens FGI94
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    D781_0635
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    D781_0635
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    D781_0635
Enzymes [BR:smaf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     D781_0635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
678491..679780
Genome map
AA seq 429 aa AA seqDB search
MKLYNLKDHNEQVSFAQAIKQGLGKQQGLFFPLELPEFELTEIDQLLKLDFVTRSARILS
AFIGEEISEEALHKRVQAAFEFPAPVAQVEDDIACLELFHGPTLAFKDFGGRFMAQMLAE
VAGDQPVTILTATSGDTGAAVAHAFYGLKNVRVVILYPQGKISPLQEKLFCTLGGNIHTV
AVDGDFDACQALVKQAFDDRELKEALHLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLDDGKWQPHATVATLSNA
MDVSQPNNWPRVEELFRRKIWQLKELGHGAVSDETTKETMKELAALGYLSEPHAAIAYRL
LRDQLQDGEFGLFLGTAHPAKFKESVEEILQQELPLPKALAVRAELPLLSHSLPADFAQL
RQFMMALPA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtacaaccttaaagatcacaatgagcaggtcagctttgcacaggcgatcaag
caggggctgggcaaacagcaggggctgtttttcccgctcgagctgccggaatttgaactg
accgagatcgaccagctgctgaagctggatttcgtgacccgcagcgcgcgtattctgtcg
gcgtttatcggtgaggaaatcagcgaagaagcgctgcacaaacgcgtgcaggccgccttt
gagttcccggcgccggtggcgcaggtcgaagacgacattgcctgtctggagctgttccac
ggcccgacgctggcgtttaaagacttcggcggtcgctttatggcgcagatgctggctgaa
gtggccggcgaccagccggtcaccattctgacggcgacctccggcgataccggcgcggcg
gtggcgcatgcgttctacggcctgaaaaacgtgcgcgtggtgatcctctatcctcagggg
aaaatcagcccgctgcaggaaaagctgttctgcacgctgggcggcaatatccataccgtg
gcggtggacggcgacttcgacgcctgtcaggcgctggtgaagcaggcgtttgacgatcgg
gagctgaaagaggcgctgcacctgaactcggccaactcgatcaacatcagccgcctgttg
gcgcagatctgctactacttcgaggcggtggcgcagctgccgcaggaagcgcgcaatcag
ctggtgatttcggtgccgagcggcaacttcggtgatttgaccgccggcctgctggccaag
tcgctgggactgccggtgaagcgctttatcgccgccaccaacgccaacgatacggtgccg
cgtttcctcgacgacggtaaatggcagccgcacgcgacggtggcgacgctctccaacgcg
atggacgtcagccagccgaataactggccgcgggtggaagagctgttccgccgcaaaatc
tggcagctgaaagagctggggcacggggcggtcagcgatgaaactaccaaagagacgatg
aaggagctggcggcgttaggctatctctccgagccgcatgcggccatcgcctaccggttg
ctgcgcgaccagctgcaggacggcgagtttggcctgttcctcggcaccgcgcatccggcg
aagttcaaagagagcgtggaagagattttacagcaggagctgccgttgccgaaggcgctg
gcggtgcgcgccgagctgccgctgctgtcgcattcgctgccggccgacttcgcgcagctg
cgtcagtttatgatggcgctgcctgcctga

DBGET integrated database retrieval system