KEGG   Serratia marcescens FGI94: D781_0635Help
Entry
D781_0635         CDS       T02433                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
smaf  Serratia marcescens FGI94
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    D781_0635
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    D781_0635
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    D781_0635
Enzymes [BR:smaf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     D781_0635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
678491..679780
Genome map
AA seq 429 aa AA seqDB search
MKLYNLKDHNEQVSFAQAIKQGLGKQQGLFFPLELPEFELTEIDQLLKLDFVTRSARILS
AFIGEEISEEALHKRVQAAFEFPAPVAQVEDDIACLELFHGPTLAFKDFGGRFMAQMLAE
VAGDQPVTILTATSGDTGAAVAHAFYGLKNVRVVILYPQGKISPLQEKLFCTLGGNIHTV
AVDGDFDACQALVKQAFDDRELKEALHLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLDDGKWQPHATVATLSNA
MDVSQPNNWPRVEELFRRKIWQLKELGHGAVSDETTKETMKELAALGYLSEPHAAIAYRL
LRDQLQDGEFGLFLGTAHPAKFKESVEEILQQELPLPKALAVRAELPLLSHSLPADFAQL
RQFMMALPA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtacaaccttaaagatcacaatgagcaggtcagctttgcacaggcgatcaag
caggggctgggcaaacagcaggggctgtttttcccgctcgagctgccggaatttgaactg
accgagatcgaccagctgctgaagctggatttcgtgacccgcagcgcgcgtattctgtcg
gcgtttatcggtgaggaaatcagcgaagaagcgctgcacaaacgcgtgcaggccgccttt
gagttcccggcgccggtggcgcaggtcgaagacgacattgcctgtctggagctgttccac
ggcccgacgctggcgtttaaagacttcggcggtcgctttatggcgcagatgctggctgaa
gtggccggcgaccagccggtcaccattctgacggcgacctccggcgataccggcgcggcg
gtggcgcatgcgttctacggcctgaaaaacgtgcgcgtggtgatcctctatcctcagggg
aaaatcagcccgctgcaggaaaagctgttctgcacgctgggcggcaatatccataccgtg
gcggtggacggcgacttcgacgcctgtcaggcgctggtgaagcaggcgtttgacgatcgg
gagctgaaagaggcgctgcacctgaactcggccaactcgatcaacatcagccgcctgttg
gcgcagatctgctactacttcgaggcggtggcgcagctgccgcaggaagcgcgcaatcag
ctggtgatttcggtgccgagcggcaacttcggtgatttgaccgccggcctgctggccaag
tcgctgggactgccggtgaagcgctttatcgccgccaccaacgccaacgatacggtgccg
cgtttcctcgacgacggtaaatggcagccgcacgcgacggtggcgacgctctccaacgcg
atggacgtcagccagccgaataactggccgcgggtggaagagctgttccgccgcaaaatc
tggcagctgaaagagctggggcacggggcggtcagcgatgaaactaccaaagagacgatg
aaggagctggcggcgttaggctatctctccgagccgcatgcggccatcgcctaccggttg
ctgcgcgaccagctgcaggacggcgagtttggcctgttcctcggcaccgcgcatccggcg
aagttcaaagagagcgtggaagagattttacagcaggagctgccgttgccgaaggcgctg
gcggtgcgcgccgagctgccgctgctgtcgcattcgctgccggccgacttcgcgcagctg
cgtcagtttatgatggcgctgcctgcctga

DBGET integrated database retrieval system