KEGG   Serratia marcescens FGI94: D781_0673Help
Entry
D781_0673         CDS       T02433                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
smaf  Serratia marcescens FGI94
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    D781_0673
   00670 One carbon pool by folate
    D781_0673
Enzymes [BR:smaf01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     D781_0673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
721109..721591
Genome map
AA seq 160 aa AA seqDB search
MIISLIAALAADRVIGMENAMPWHLPADLAWFKRNTLNKPVIMGRKTFESIGRPLPGRHN
IVLSSRPGSESGVTWATSLDEALAAAGNVEEVMVMGGGHIYTQFLPRADRLYLTHIDAEI
GGDTHFPDYEPDEWETSFSEFHDADAQNSHSYCFEILERR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgatcattagcctgatcgctgcgttggcggcggatcgcgtaatcggcatggaaaacgcc
atgccgtggcacctgccggcggatttagcgtggtttaaacgtaacacgttgaataaaccg
gtcattatgggtcgcaagacctttgagtcgattggccgcccgctgccgggccgtcacaat
atcgtgctgagcagccggccgggcagcgaaagcggcgtgacctgggcgacctcgctggac
gaggccctggcggcggccggcaatgtggaagaagtgatggtgatgggcggcgggcatatt
tatacccagtttctgccgcgcgccgatcgtctgtacctgacgcatattgatgccgaaatc
ggcggcgatacgcatttcccggattatgagcctgacgagtgggaaacctcattcagcgaa
ttccatgatgcagacgcgcagaattctcacagctactgcttcgagattttagagcgccgt
taa

DBGET integrated database retrieval system