KEGG   Serratia marcescens FGI94: D781_0673Help
Entry
D781_0673         CDS       T02433                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
smaf  Serratia marcescens FGI94
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:smaf00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:smaf00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
721109..721591
Genome map
AA seq 160 aa AA seqDB search
MIISLIAALAADRVIGMENAMPWHLPADLAWFKRNTLNKPVIMGRKTFESIGRPLPGRHN
IVLSSRPGSESGVTWATSLDEALAAAGNVEEVMVMGGGHIYTQFLPRADRLYLTHIDAEI
GGDTHFPDYEPDEWETSFSEFHDADAQNSHSYCFEILERR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgatcattagcctgatcgctgcgttggcggcggatcgcgtaatcggcatggaaaacgcc
atgccgtggcacctgccggcggatttagcgtggtttaaacgtaacacgttgaataaaccg
gtcattatgggtcgcaagacctttgagtcgattggccgcccgctgccgggccgtcacaat
atcgtgctgagcagccggccgggcagcgaaagcggcgtgacctgggcgacctcgctggac
gaggccctggcggcggccggcaatgtggaagaagtgatggtgatgggcggcgggcatatt
tatacccagtttctgccgcgcgccgatcgtctgtacctgacgcatattgatgccgaaatc
ggcggcgatacgcatttcccggattatgagcctgacgagtgggaaacctcattcagcgaa
ttccatgatgcagacgcgcagaattctcacagctactgcttcgagattttagagcgccgt
taa

DBGET integrated database retrieval system