KEGG   Serratia marcescens FGI94: D781_0915Help
Entry
D781_0915         CDS       T02433                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
smaf  Serratia marcescens FGI94
Pathway
smaf00330  Arginine and proline metabolism
smaf00332  Carbapenem biosynthesis
smaf01100  Metabolic pathways
smaf01130  Biosynthesis of antibiotics
smaf01230  Biosynthesis of amino acids
Module
smaf_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    D781_0915
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    D781_0915
Enzymes [BR:smaf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     D781_0915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AGB81248
UniProt: L0MBI0
Position
975529..976632
Genome map
AA seq 367 aa AA seqDB search
MNGSQTLVVKLGTSVLTGGSLRLNRAHIVELVRQCAQQHAAGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADLEDRERFLNARDT
MNALLDNRIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQPGLFTADPR
NNPQAELIREVHGIDDALRAIAGDSVSGLGTGGMGTKLQAADVACRAGVDVVIAAGGKPG
VVADVIDGNPVGTRFHAQEAPLENRKRWIFGAPPAGEITVDDGAVDAIMARGSSLLPKGI
REVKGDFSRGEVIRIRNLAGRDLAHGVSRYNSDAMRMIAGHHSQQISDILGYEYGPVAVH
RDDMIVS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcagccagacattggttgtgaaattgggcaccagcgtgttgaccggcggatcg
ctgcgtctgaaccgcgcccatattgtcgagctggtgcgccagtgcgcacagcaacatgct
gcgggtcaccgcattgttattgtcacctccggggcgattgccgccgggcgtgagcatcta
ggctaccccgagctgcccgctactatcgcttcgaaacagctgctggcggcggtggggcag
agccgcctgatccagctgtgggagcagctgttttcgatttacggcatccacgtcgggcag
atgctgctgacgcgcgccgatctggaagaccgtgagcgtttccttaacgcgcgcgacacc
atgaatgcgctgctggataaccgcatcgtgccggtgatcaatgagaacgatgcggttgcc
actgcggagatcaaagtcggcgataacgacaacctgtcggcgctggcggcgattctggcc
ggtgcagacaaactgctgctgctgaccgatcagccgggcctgttcaccgccgacccacgc
aacaacccgcaggcggagctgattcgcgaagtgcacggcattgacgatgcgctgcgggcg
attgccggcgacagcgtttccggcctgggcaccggcgggatgggcaccaaactgcaggcg
gccgacgtggcctgccgcgcgggcgtcgacgtggtgatcgccgccggtggcaagccgggc
gtggtggccgacgtgatcgacggcaacccggtaggcacccgtttccacgcgcaggaagcc
ccgctggagaaccgtaagcgctggatcttcggcgcgccgccggccggcgaaatcaccgtg
gatgacggcgcggttgacgccattatggcgcgcggcagctcgctgctgccgaagggcatc
cgcgaggtgaagggggacttctcccgtggcgaagtgatccgcatccgcaacctggcgggg
cgcgatctggcccacggcgtcagccgctataacagcgacgccatgcgcatgattgccgga
caccactcgcagcaaatcagtgatattctcggttatgaatacggcccggtggccgtgcac
cgcgacgatatgatcgtaagttaa

DBGET integrated database retrieval system