KEGG   Serratia marcescens FGI94: D781_1060Help
Entry
D781_1060         CDS       T02433                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
smaf  Serratia marcescens FGI94
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    D781_1060
DNA repair and recombination proteins [BR:smaf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      D781_1060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1121188..1121793
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLESLMEALRCLPGVGPKSAQRMAFQLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQDVCTICANPRRQQNGQICVVESPADIHAIEQTGQFAGRYFVLMGHLSPLDGIGP
ADIGLDRLEQRLEQEEIAEVILATNPTVEGEATANYIAEMCGQYGVLASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHAIKF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagtccgctgctggagtcattgatggaagcgttgcgctgcctgccgggcgtt
ggcccgaagtcggcgcagcgtatggcgttccaactgctgcaacgggatcgcagcggcggt
atgcgtttggcgcaggcgctgacccgcgccatgtcggaaatcggccattgcgccgattgc
cgcacctttaccgagcaagacgtctgcaccatttgcgccaatccgcgccgtcagcaaaac
ggccagatttgcgtggtggagagcccggcggatatccatgccattgagcagaccggccag
ttcgccggccgctactttgtgctgatggggcatctgtcgccgctggacggcatcggcccg
gccgatatcggcctcgaccggctggagcagcggcttgagcaggaggagatcgccgaggtg
atcctggcgaccaacccgacggttgaaggtgaagccaccgccaactacatcgcggaaatg
tgcggccagtacggcgtgctggccagccgcatcgcccacggggtgccggttggcggcgag
ctggaaatggtcgacggcaccacgctgtcgcactcgctggccgggcgtcacgccatcaaa
ttctga

DBGET integrated database retrieval system