KEGG   Serratia marcescens FGI94: D781_1081Help
Entry
D781_1081         CDS       T02433                                 

Definition
lysophospholipase L1-like esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
smaf  Serratia marcescens FGI94
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    D781_1081
Enzymes [BR:smaf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     D781_1081
   3.1.2  Thioester hydrolases
    3.1.2.-  
     D781_1081
Lipid biosynthesis proteins [BR:smaf01004]
 Fatty acid synthase
  Component type
   D781_1081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1143779..1144408)
Genome map
AA seq 209 aa AA seqDB search
MNFKNVFRWHFPILLLLALFSLRAAAADTLLILGDSLSAGYRLPVAQAWPARLAERWQKQ
PGSPKVINASISGDTAAQGLARLPALLKQHRPRWVLIELGANDGLRGFPPPDLQRDLEQI
ITLTQQAGARPLLMQIRIPPNYGRRYTESFSAVYPRLAEQFKIPLLPFFMEQVAIKPEWM
QDDSLHPNLDAQPFIANWMAERLAPLVTQ
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcaagaacgttttccgctggcattttcccatccttttactgttggctttattc
agtttacgtgcggcggcggccgatacgttattgattcttggcgacagcctcagcgccggc
taccgtctgccggtggcgcaggcctggccggcgcggctggccgaacggtggcagaaacag
cccggcagccccaaagtgatcaacgccagcatcagcggcgacaccgccgcccaggggctg
gcgcgcctgccggcgctgctgaagcagcatcggccgcgctgggtgttgattgagctcggc
gccaacgacgggctgcgcggttttccgccgccggatctgcagcgcgaccttgagcaaatc
atcaccctgacgcagcaggcgggcgcccgcccgttgctgatgcagattcggataccaccg
aactacggccgccgctatactgagtcgttcagcgcggtctatccgcgacttgccgagcag
ttcaagatccccctgctgccgttctttatggagcaggtggcgattaaaccggagtggatg
caggatgacagcctgcacccgaatctggacgcccagccgtttatcgccaactggatggcg
gaacgcctggcgccgttagtgacacaataa

DBGET integrated database retrieval system