KEGG   Serratia marcescens FGI94: D781_1157Help
Entry
D781_1157         CDS       T02433                                 

Definition
N-acetyl-beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
smaf  Serratia marcescens FGI94
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:smaf00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:smaf00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1213382..1216045
Genome map
AA seq 887 aa AA seqDB search
MNKFKLSALAVLAATAGMFGAAGSAMADQPLVERLSQLKLNIKMLDNRAADSGVDCARLG
ADWAACNKVLITLANGGQAITAKDWAIYFHSPRQTLEVGNKQFRITHLTGDLYKLEPTAA
FRGFPANQAVEIPIVAEYWQLFKTDFLPRWYATAGDAKPQVLVNTDTEDLDRFVAPFGDD
QWKRTKDDNNVLMTPASRFTRNADVQTLPAASLRGQIIPTPMSVQIHAQDIDLGNGVALN
LDALEPASAEVVRERFKQLGVASVATGYPIVTEIRPASFSGEIAQSGAYKLTLSEKEARI
TGFDQSGVFYGLQSILSLIPLNGEKKIAALEASDAPRFAYRGLFLDVARNFHHKDAVLRL
LDQMAAYKLNKFHFHLTDDEGWRIEIPGLPELTDVGAQRCHDLSETTCLLPQYGQGPGVY
GGFFSRQDYIDILKYAQARHIEVIPEIDMPAHARAAVVSMEARYQKLMAQGKQQEAEAYR
LVDPTDTSNTTSVQFFNRQSYLNPCLDSSTRFVDKVMGELVKMHQEAGQPIGTWHFGGDE
AKNIRLGAGYTDVKKPEAGKGMLDLSKEDKPWAKSQACQRLIDSGKVADMEHLPSYFGQE
VSKLVKAHGIDRMQAWQDGLKDAKDAKAFATSRVGVNFWDTLYWGGFDSVNDWANKGYEV
VVSNPDYVYLDFPYEVNPNDSGYYWGTRFSDERKIFSFAPDNMPQNAETSVDRDGNAFSA
KSDKPWPGAHGLSAQLWSEVVRTDPQMEYMIFPRALSVAERAWHRADWELDYQAGREYKG
GETRFVDGKKLAQEWQVFANILGQRELAKLDAGGISYRLPVPGARIVGGRLEANIALPGL
TIEYSTDGGQRWQRYDDAARPAVQGEVQVRSASPDGKRFSRAEPVTA
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatttaaactgagtgccctggccgtattggcggcgaccgccggcatgttcggc
gcggccggcagcgccatggcggatcagccgctggtggagcgcctcagccagctgaagctg
aatatcaaaatgctggataaccgcgccgccgacagcggcgtggactgcgccaggctgggt
gccgactgggcggcctgcaacaaggtgctgatcacgctggccaacggcggccaggcgatt
accgccaaagactgggccatctatttccacagcccgcgtcagacgctggaggtgggcaat
aagcagttccgcatcactcacctgaccggcgatctgtataagctggagccgaccgcggcg
ttccggggcttcccggccaaccaggcggtggaaattcccattgtggcggagtactggcag
ctgtttaagaccgatttcctgccgcgctggtatgccaccgctggcgacgctaaaccgcag
gtgctggtcaataccgatactgaagatctggaccggtttgtggcgccgttcggcgacgac
cagtggaagcgcaccaaagacgataacaacgtgctgatgacgccggcctcgcgctttacg
cgcaacgcggatgtgcagacgttgccggccgcctcgctgcgcggccagattatcccgacg
ccgatgtcggtacagatccatgcgcaggatatcgatcttggcaacggcgtggcgctgaac
ctcgacgcgctggagccggcgtcagcggaggtggtgcgcgagcgctttaagcagcttggc
gtcgcaagtgtggcgacgggctatccgatcgtcaccgagatcagaccggcatcgtttagc
ggcgagatagcgcaatccggcgcctataaactgacgctgagcgagaaggaagcgcggatt
accggctttgaccagagcggggtgttctacggtctgcagtccattttgtcgctgattccg
ctgaatggcgagaagaagattgccgcgctggaggcgagcgacgcgccgcgctttgcctac
cgcgggctgttcctcgacgtggcgcgcaatttccaccataaggacgccgtgctgcgcctg
ctggatcagatggcggcctataagctgaataaattccatttccacctgaccgatgatgag
ggctggcgtattgaaatccctggcctgccggagttgacggacgtcggtgcgcagcgctgc
catgacctgagcgaaaccacctgtctgctgccgcagtacggtcaggggccgggtgtctac
ggcggtttcttctcgcgccaggattacatcgacattctcaagtatgcgcaggcgcgacat
attgaggtgatcccggaaatcgacatgccggcgcacgcccgcgcggcggtagtttccatg
gaggcgcgctaccagaaactgatggcgcagggcaagcagcaggaggcggaggcgtaccgg
ctggtcgacccgaccgatacctcgaacaccacctcggtacagttcttcaaccgccagagc
tacctgaacccgtgcctggactcctccacccgctttgtcgacaaagtgatgggggaactg
gtcaaaatgcatcaggaggcggggcagccgatcggcacctggcactttggcggcgatgag
gcgaaaaacatccgtctgggggccggttacaccgacgtgaagaaacctgaggcgggcaag
gggatgctcgatctgagcaaggaagataagccatgggcgaagtcgcaggcctgccagcgg
ctgatcgacagcggtaaagtggcggatatggaacatctgccgagctactttggccaggag
gtcagcaagctggtgaaggcgcacggtatcgatcggatgcaggcctggcaggatggcctg
aaagatgccaaggacgccaaagcgttcgccacctcgcgcgtgggcgtcaacttctgggat
accctgtactggggcggctttgactcggtgaacgactgggccaacaagggttatgaagtg
gtggtctccaacccggactatgtctatttggacttcccgtatgaagtgaatccgaacgac
agcggctattactggggcacccgcttcagcgacgagcgcaagatcttcagctttgccccg
gacaatatgccgcaaaacgccgaaacctcggttgaccgcgacggcaacgcgttcagcgcc
aaaagcgacaagccgtggccgggggcgcacggtctgtccgcccagctgtggagcgaggtg
gtacgaaccgatccgcagatggagtatatgatcttcccacgtgcgctgtcggtggccgag
cgcgcctggcaccgcgccgactgggaactggactatcaggcgggccgcgagtacaagggg
ggggaaacccgctttgtcgacggcaaaaagctggcgcaggagtggcaggtttttgccaat
atcctggggcagcgtgagctggccaagctggatgcgggtggcatcagttaccgtctgccg
gtgccgggcgcgcgcatagtcggcggcaggctggaagccaatattgcgctgccgggcctg
accatcgagtattcgaccgacggcggccagcgctggcagcgttatgatgacgccgccaga
ccggcggtgcagggcgaggtgcaggtgcgttcggcaagcccggacggcaagcgcttcagc
cgtgcggagccggtaacggcctaa

DBGET integrated database retrieval system