KEGG   Serratia marcescens FGI94: D781_1190Help
Entry
D781_1190         CDS       T02433                                 

Definition
2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
smaf  Serratia marcescens FGI94
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    D781_1190
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    D781_1190
  Amino acid metabolism
   00310 Lysine degradation
    D781_1190
Enzymes [BR:smaf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     D781_1190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1249687..1250901
Genome map
AA seq 404 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDSVERDEVLVEIETDKVVLEVPASEAGVLDAI
VEDEGATVLSRQILGRIRPGASGDKPAAEPAKAAEAAPAAQAAPAAAAEESNDALSPAIR
RLIAEHDLDASAIKGSGVGGRITREDVEAHLANGGKKAAPAAEAAPQPALSARSEKRVPM
TRLRKRVAERLLEAKNSTAMLTTFNEINMQPIMDLRKQYGEAFEKRHGVRLGFMSFYIKA
VVEALKRYPEVNASIDGDDVVYHNYFDVSIAVSTPRGLVTPVLRDVDTMSMAEIEKKIKE
LAVKGRDGKLKVEELTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVNGQ
VVIQPMMYLALSYDHRLIDGKESVGYLVTVKEMLEDPARLLLDV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattctggttcctgaccttcctgaatcggttgccgatgcgacggta
gcgacctggcataaaaaaccgggcgacagcgttgagcgtgacgaagttctggtggaaatc
gaaaccgataaggtggtgctggaagttccggccagtgaagcgggcgtgcttgacgccatc
gtggaagatgaaggcgccaccgtgctttctcgccagatcctgggccgtatccgcccgggc
gccagcggcgacaagccggctgcggaacctgctaaagcagcggaagctgcgccggcagca
caggcagcgcctgccgctgcggcagaagaaagcaacgatgcgctcagcccggcgattcgt
cgcctgattgccgagcacgacctggacgccagcgccatcaaaggcagcggcgtcggcggc
cgtatcacgcgtgaagacgtggaagcccacctggcgaacggtggcaagaaagcggctccg
gctgcagaagccgcacctcagccggcgctgagcgcacgttctgaaaaacgcgtgccgatg
acccgtctgcgcaagcgcgtggccgagcgtctgctggaagcgaagaacagcaccgccatg
ttgacgaccttcaacgaaatcaacatgcagccgattatggacctgcgcaagcagtacggc
gaagcgttcgaaaaacgtcacggcgtgcgtctgggcttcatgtccttctacatcaaagcg
gtagtagaagcgctgaagcgttacccggaagtgaatgcgtcaatcgacggcgatgatgtg
gtgtaccacaactacttcgacgtcagcatcgcggtatccacgcctcgcggcctggtgacc
ccggttctgcgcgacgtagacaccatgtccatggctgaaatcgagaagaaaatcaaagag
ctggcggtcaaaggccgtgacggcaaattgaaagtggaagagctgaccggcggtaacttc
accatcaccaacggcggcgtcttcggttctctgatgtctacgccgatcatcaacccgccg
cagagcgccattctgggcatgcacgccattaaggatcgtccgatggcggtcaacggccag
gttgtgattcagccaatgatgtatctggcgctttcttatgaccaccgcctgatcgacggc
aaagagtctgtcggttatctggtgacggtgaaagagatgctggaagatccggctcgtctg
ctgctggacgtgtag

DBGET integrated database retrieval system