KEGG   Serratia marcescens FGI94: D781_1191Help
Entry
D781_1191         CDS       T02433                                 

Definition
succinyl-CoA synthetase, beta subunit
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
smaf  Serratia marcescens FGI94
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    D781_1191
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    D781_1191
   00640 Propanoate metabolism
    D781_1191
   00660 C5-Branched dibasic acid metabolism
    D781_1191
Enzymes [BR:smaf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     D781_1191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1251021..1252187
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGMPAPTGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KVVNSKEDIRAFAEAWLGKRLVTYQTDAQGQPVHQILVEAATDIDKELYLGAVVDRGTRR
IVFMASTEGGVEIEKVAEETPELIHKTTIDPLAGPQPYQGRELAFKLGLSGKQVSQFAKI
FMGLATLFLERDLAMVEINPLVITKQGDLVCLDGKLGADGNALFRQPELREMQDLSQEDE
RESRAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDDKVKAVLVNIFGGIVRCDLIADGIIGAVAEVGVSVPVVVRLEGNNADLGAKK
LADSGLNIIAATSLTDAAQQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgaatatcaggcaaaacagttgtttgctcggtatggtatgccggcacca
accggttacgcctgtactacaccgcgtgaagcagaagaagccgcgtccaaaatcggcgcc
ggtccgtgggtagttaaatgtcaggttcatgctggcggccgcggcaaagccggcggcgtt
aaagtggtaaacagcaaagaagatatccgcgctttcgctgaagcctggttgggcaagcgt
ctggtgacctaccaaactgacgcgcagggccagccggttcaccagatcctggttgaagcc
gctaccgatatcgataaagagctgtatctgggcgcggtggttgaccgcggcacccgtcgc
atcgtgttcatggcgtctaccgaaggcggcgtggaaatcgagaaagtggcggaagaaacg
ccggaactgatccacaaaaccaccattgatccgctggcgggcccgcagccttaccagggc
cgtgagctggcgttcaaactgggcctgagcggcaagcaggtcagccagttcgccaaaatc
ttcatgggtctggcgacgctgttcctggaacgcgacctggcgatggttgagatcaacccg
ctggtaatcaccaagcagggtgacctggtgtgtctggacggcaaactgggtgccgacggc
aacgccctgttccgtcagccggaactgcgtgaaatgcaggatctgtctcaggaagatgag
cgcgaatcacgtgcggcgcagtgggaactgaactacgtcgcgctggatggcaacatcggc
tgcatggttaacggtgcaggcctggcgatgggcaccatggacattgtcaaactgcacggc
ggcgaaccggccaacttcctggacgtgggcggcggcgcaaccaaagagcgcgtgaccgaa
gcgtttaaaatcatcctgtccgacgacaaggtgaaagcggttctggtgaacattttcggt
ggtatcgtgcgttgcgacctgatcgccgacggtatcattggcgcagtggccgaagtgggc
gttagcgtcccggtggttgtgcgtttggaaggtaacaatgccgatctgggcgccaagaaa
ctggcggacagcggtctgaatatcattgctgcgaccagcctgactgatgcggctcagcaa
gttgttgcggcagtggagggtaaataa

DBGET integrated database retrieval system