KEGG   Serratia marcescens FGI94: D781_1445Help
Entry
D781_1445         CDS       T02433                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
smaf  Serratia marcescens FGI94
Brite
Enzymes [BR:smaf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     D781_1445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1505937..1506641)
Genome map
AA seq 234 aa AA seqDB search
MFDATEFPITRRWPAQHPERLQLYSLPTPNGVKVSIMLEETGLPYEAHLIDIGQNETWTP
EFLSLNPNGKIPAILDPVGPDGKPLALFESGAILLYLAEKCGEFLPQDPVQRIETIQWVF
FQMAAVGPMFGQLGFFHKFAGREYEDKRPLQRYQKESQRLLGVLETRLENREWIMGADYT
IADISLLGWVRNLIGFYEARELVSFDSFPRVGAWLERGLERPAVQRGLNIPARP
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatgccaccgaattccccatcacccgccgctggccggcgcagcatccggagcgg
ctacagctctattccctgccgacgcctaatggcgtcaaagtatcgattatgctggaagag
accggcctgccttatgaagcgcacctgattgacatcggccagaacgaaacctggacgccg
gagtttctgtcattgaaccccaacggcaaaatcccggcgatcctcgatccggtcgggccg
gacggcaaaccgctggcgctgttcgaatccggcgccatcctgctgtatctggcggagaag
tgcggcgaatttctgccgcaggatccggtgcagcgcattgaaaccattcaatgggtcttc
ttccagatggcggcggtggggccgatgttcggccagctcggcttcttccacaaattcgcc
ggacgggaatacgaagacaagcgcccgctgcagcgctatcagaaagagtcgcagcgcctg
ctcggcgtgctggaaacccggctggaaaaccgtgaatggatcatgggcgcggactacacc
atcgccgatatctccctgctcggctgggtgcgcaacctgattggtttctacgaggcgcgc
gagctggtgtcgttcgacagcttcccccgcgtcggcgcctggctggagcgcggcctggaa
cgcccggcggtgcaacgcggcctgaacatcccggcgcgtccgtaa

DBGET integrated database retrieval system