KEGG   Serratia marcescens FGI94: D781_1468Help
Entry
D781_1468         CDS       T02433                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
smaf  Serratia marcescens FGI94
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    D781_1468
Enzymes [BR:smaf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     D781_1468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1527845..1528507
Genome map
AA seq 220 aa AA seqDB search
MTTLSKEAALVHAALEARGLETPLRGEMLDRETRKRRIQEHMTEIMQLLNLDLSDDSLAE
TPHRIAKMYVDEIFSGLDYANFPKITVIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKA
TVAYIPKDGVIGLSKINRIVQFFAQRPQVQERLTQQILIALQTLLGTNNVAVSIDAVHYC
VKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHQ
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgacgacactcagtaaagaagcggctctggttcatgcagcgctggaggctcgcggcctg
gaaaccccgctgcgtggtgaaatgttggatcgcgaaacgcgtaaacggcgtattcaggag
cacatgacggaaatcatgcagctgctgaacctcgatctgagcgatgacagcctggcggaa
acgccgcaccgcatcgccaagatgtatgtcgatgagatcttttccggtctggattacgcc
aatttcccgaagatcaccgtgattgaaaacaaaatgaaggtggatgaaatggtgacggtg
cgcgacatcaccctgaccagcacctgcgaacaccatttcgtcaccatcgacgggaaggcc
accgtggcctatatcccgaaagacggggtgatcgggctgtccaaaatcaaccgtatcgtc
cagttctttgcccagcgtccgcaggtgcaggagcgtctgacccagcagatcctgatcgcg
ctgcaaacgctgctcggcaccaacaacgtggcggtatcgattgacgcggtgcactactgc
gtcaaggcgcgcggcattcgcgacgccaccagcgccaccaccaccacctcgctgggcggg
ctgttcaagtccagtcagaacacgcggcaggagttcctgcgcgcggtgcgtcaccaccag
taa

DBGET integrated database retrieval system