KEGG   Serratia marcescens FGI94: D781_1490Help
Entry
D781_1490         CDS       T02433                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
smaf  Serratia marcescens FGI94
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    D781_1490
   00052 Galactose metabolism
    D781_1490
   00500 Starch and sucrose metabolism
    D781_1490
   00520 Amino sugar and nucleotide sugar metabolism
    D781_1490
Enzymes [BR:smaf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     D781_1490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1554152..1555045
Genome map
AA seq 297 aa AA seqDB search
MTKLKAVIPVAGLGMRMLPATKAIPKEMLPIVDKPLIQYIVNECVAAGIKEIILVTHSSK
NAIENHFDTSFELEAMLEARVKRQLLDEVQSITPKGVTLMHIRQGQPKGLGHAVLCAKPL
VGDSPFVVLLPDVLLDDAQADLSKDNLPHMIARFEQTGLSQVLVQAADEHVLHDYSVVEC
ETDTLKPGETSRMTSIIEKPGLDVQLKSNYSAVGRYVLSADIWPLLEKTEPGAWGRVQLT
DAIAELLRQQPVEATELVGQSFNCGEKMGYLRAFVTYGLRHPTQGKAFREWAEQQVL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagttgaaagctgtcattcccgttgccggcctcggcatgcgcatgctgccggca
accaaggcaattccaaaagaaatgttgccgatcgtcgataagccgctcattcagtatatc
gttaatgaatgcgtagctgccgggatcaaggagatcattctggttacgcattcgtccaaa
aatgccattgagaatcatttcgatacctcgtttgagctggaagcgatgctggaagcacgc
gttaaacgccagctgcttgatgaagtgcagtcaatcacgccgaaaggcgtgacgctgatg
catattcgccaggggcagccaaaaggtctaggtcatgcggtgctgtgcgccaagccgttg
gttggagattctcctttcgtcgtgctgttgccggatgtcttgcttgatgatgcgcaagcc
gacctgagcaaagataacctgccgcatatgattgcccgcttcgaacagacgggactcagt
caggtgctggtgcaggcagcagacgaacatgtgttgcatgattactcggttgttgaatgt
gaaacggatacgttgaaaccaggcgagacttcacggatgacgtccattattgaaaagccg
ggccttgatgtgcagttaaaatctaactattccgccgtgggtcgctatgtgcttagcgct
gatatctggccgcttcttgaaaaaaccgagccgggcgcctgggggcgggtgcagctgact
gatgcgattgccgagctgctgcgccagcagccggttgaagccaccgagctggtcgggcag
tcatttaactgtggtgaaaagatgggttatttacgcgcatttgtcacctatggcttacgc
cacccgactcagggcaaggcgtttcgcgagtgggctgagcagcaggtactttaa

DBGET integrated database retrieval system