KEGG   Serratia marcescens FGI94: D781_1498Help
Entry
D781_1498         CDS       T02433                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
smaf  Serratia marcescens FGI94
Pathway
smaf00521  Streptomycin biosynthesis
smaf00523  Polyketide sugar unit biosynthesis
smaf01130  Biosynthesis of antibiotics
Module
smaf_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    D781_1498
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    D781_1498
Enzymes [BR:smaf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     D781_1498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom DUF4738
Motif
Other DBs
NCBI-ProteinID: AGB81804
UniProt: L0MCY9
Position
1563598..1564134
Genome map
AA seq 178 aa AA seqDB search
MQVTDSKIDGVKIIQPKVFGDARGFFLETFEKKRYQEMLNIDLDFVQDNHSRSAKGVLRG
LHFQKVNPQGKLVRVVRGEVFDVAVDIRPGSPTFGQWEGVILSEENKTQFWVPPGLAHGF
VVLSDIADFEYKCTDYYNPSHEGCLLWNDPEVGIEWPIDNPLLSEKDKVGKLLKELAK
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtaactgatagcaaaattgacggcgtcaaaattatccagccgaaggtatttggc
gacgcgcgcggttttttcctggaaactttcgagaaaaagcgctaccaggaaatgctgaat
attgacctcgattttgtgcaggataaccattcacgctctgccaagggcgtgctgcgcggt
ttacatttccaaaaggtaaacccgcagggcaagttggtgcgtgtggtgcgtggcgaagtc
tttgatgtcgccgtggatattcgtcctggctcgccgacgttcggccagtgggaaggagtc
atcctgtccgaagagaataaaacccagttctgggtgccgccgggcctggcgcatggtttt
gtcgtgctgtctgacattgccgattttgagtacaagtgcaccgattactacaaccctagc
catgaaggttgcctgctgtggaacgacccagaggtaggtattgaatggccaatcgataat
ccgctgctgtctgaaaaagacaaagtgggcaagctgctcaaggagctggcgaaatga

DBGET integrated database retrieval system