KEGG   Serratia marcescens FGI94: D781_1498Help
Entry
D781_1498         CDS       T02433                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
smaf  Serratia marcescens FGI94
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:smaf00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:smaf00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1563598..1564134
Genome map
AA seq 178 aa AA seqDB search
MQVTDSKIDGVKIIQPKVFGDARGFFLETFEKKRYQEMLNIDLDFVQDNHSRSAKGVLRG
LHFQKVNPQGKLVRVVRGEVFDVAVDIRPGSPTFGQWEGVILSEENKTQFWVPPGLAHGF
VVLSDIADFEYKCTDYYNPSHEGCLLWNDPEVGIEWPIDNPLLSEKDKVGKLLKELAK
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtaactgatagcaaaattgacggcgtcaaaattatccagccgaaggtatttggc
gacgcgcgcggttttttcctggaaactttcgagaaaaagcgctaccaggaaatgctgaat
attgacctcgattttgtgcaggataaccattcacgctctgccaagggcgtgctgcgcggt
ttacatttccaaaaggtaaacccgcagggcaagttggtgcgtgtggtgcgtggcgaagtc
tttgatgtcgccgtggatattcgtcctggctcgccgacgttcggccagtgggaaggagtc
atcctgtccgaagagaataaaacccagttctgggtgccgccgggcctggcgcatggtttt
gtcgtgctgtctgacattgccgattttgagtacaagtgcaccgattactacaaccctagc
catgaaggttgcctgctgtggaacgacccagaggtaggtattgaatggccaatcgataat
ccgctgctgtctgaaaaagacaaagtgggcaagctgctcaaggagctggcgaaatga

DBGET integrated database retrieval system