KEGG   Serratia marcescens FGI94: D781_1840Help
Entry
D781_1840         CDS       T02433                                 

Definition
beta-glucosidase-like glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
smaf  Serratia marcescens FGI94
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    D781_1840
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    D781_1840
Enzymes [BR:smaf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     D781_1840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1940298..1941335
Genome map
AA seq 345 aa AA seqDB search
MGPVMLDVAGYELDAEEREILQHPLVGGLILFTRNFHDAQQLRELVRQIRAASHDRLVVA
VDQEGGRVQRFREGFTCLPAAQSFAALNDAAEAGRLAQEAGWLMAAEMIAQDIDISFAPV
LDIGHVSAAIGERSFHQDPTQALAMAERFIQGMHSAGMRTTGKHFPGHGAVSADSHKETP
RDPRPLATIRNHDMSIFRALIERRLLDAVMPAHVIYTEADPRPASGSPYWLQQILRQELG
FDGIIFSDDLSMEGAAVMGSYAERGQAALDAGCDMILVCNNRAGAVSVLDNLSPVKVDKL
KRLYHQGQFTRQALRDSERWKLAHQQLSALSERWEEYKQRGEVNQ
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtgggcccagtaatgttagacgtcgccggctatgagctggatgccgaagagcgcgaaatt
ttacagcatccgctggtgggcggtttgattctgtttacccgcaacttccacgatgcgcag
cagctgcgtgagctggtgcggcagatccgcgcggcgtcccacgatcgactggtggtggcg
gtcgatcaggaaggcggccgcgtacaacgcttccgcgaaggttttacctgcctgccggcg
gcgcagtcgttcgccgccctcaatgacgcggcggaagcggggcgactggcgcaggaggcc
ggctggctgatggcggcggagatgatcgcgcaggatatcgatatcagctttgcgccggtg
ttggatatcggccacgttagcgcggcgattggcgagcgctctttccaccaggatccgacg
caggcgctggcgatggcggaacgctttatacaggggatgcacagcgccggcatgcgcacc
accggcaaacatttcccggggcacggcgcggtcagcgccgactcgcataaagaaaccccg
cgcgatccgcgtccgctggcgaccatccgcaatcacgacatgtcgattttccgcgcgctg
attgagcgccggctgctggacgcggtgatgccggcccacgttatctatactgaggctgac
ccgcgtccggccagcggctcgccgtactggctgcagcaaattctgcgtcaggagctgggc
tttgacggcatcatcttctctgacgatctgtcgatggaaggcgcggcggtgatgggcagc
tacgctgaacgcggccaggcggcgctggatgccggctgcgatatgattctggtgtgcaac
aaccgcgccggcgcggtcagtgtgctggataacctgtccccggtcaaagttgacaagctt
aagcggctgtatcatcaggggcagtttacccgtcaggcgctgcgcgattccgaacgctgg
aaactggcgcatcagcaactgagcgcgctgagcgagcgctgggaagagtacaaacagcgc
ggcgaggtcaaccaataa

DBGET integrated database retrieval system