KEGG   Serratia marcescens FGI94: D781_2084Help
Entry
D781_2084         CDS       T02433                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
smaf  Serratia marcescens FGI94
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    D781_2084
Enzymes [BR:smaf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     D781_2084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2199520..2200125)
Genome map
AA seq 201 aa AA seqDB search
MKLFYKAGACSLSPHIVLREAGLDFTAEKVDLANKTTESGADYLTINPKGQVPALLLDDG
SLLTEGVAIVQYLADRVPDRQLIPPAGTLSRYHAIEWLNFVASELHKGFSPLFNPKTPEA
YLAIARAKLEQHFRYLDGVLAPQHYLLGSRFSVADAYLFTVLRWAVALQFDLQRYPNLAG
YMKRVAARPAVAAALNAEGLQ
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctataaagccggcgcctgttccctgtccccgcatatcgtactgcgcgag
gcggggctggatttcaccgcggaaaaagtcgatctggccaataaaaccaccgagagcggc
gccgactatctgacgattaaccccaaaggacaggttccggcgctgctgctggacgacggc
agcctgctgaccgaaggcgtggcgatagtgcagtatttggcggatcgggtgcccgaccgt
cagctgatcccgccggcgggcacgctgtcgcgctaccacgcgattgaatggctgaacttt
gtcgcctccgaactgcacaagggcttcagcccgctgtttaatccgaaaacgccggaagcg
tatctggcgattgcgcgcgccaaactggagcagcatttccgctatcttgacggcgtgctg
gcgccgcaacactacctgctgggcagccgcttcagcgtcgctgacgcctacctgtttacc
gtactgcgctgggcggtggcgctgcagtttgatctgcagcgctatccaaacctggccggc
tatatgaaacgggtggcggcgcgtccggcggtggccgccgcgctgaatgccgaagggttg
cagtaa

DBGET integrated database retrieval system