KEGG   Serratia marcescens FGI94: D781_2166Help
Entry
D781_2166         CDS       T02433                                 

Definition
dehydrogenase of unknown specificity, short-chain alcohol dehydrogenase like protein
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
smaf  Serratia marcescens FGI94
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:smaf00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:smaf00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2281944..2282666)
Genome map
AA seq 240 aa AA seqDB search
MEPHDSAPVLITGGARRIGLALARSLLQRQVPVIVAYRSDYPALAELKSLGATCIQADFS
THDGIYQFAEQVREIAPKLRALVHNASAWQAESPYTPPEQVMASMLQIHVYTPYLLNQLL
EPCLRGQGQAGADIIHLTDYVVEKGSDKHIAYAASKAALDNMTRSFARKLAPEVKVNAIA
PALIIFNPGDDEAYRQQALQKSLMKVAPGESEVVELVHYLLGSRYVTGRTHGVDGGRPLR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggaaccccatgactctgcgccggtgctgatcaccggtggcgcccgccgcataggcctg
gcgttggcccgttcgctgctgcagcgccaggtaccggtgatcgtcgcctaccgcagcgac
tatccggcgctcgccgagcttaaatcactgggcgccacctgtattcaggccgatttctcc
acccacgacggcatctatcagtttgccgaacaggtgcgggaaatcgcccctaaactgcgg
gcgctggtgcataacgccagcgcctggcaggccgaatcgccgtatacgccgccggagcag
gtgatggcgtcgatgctgcaaatccacgtttacaccccctatctgctcaaccaactgcta
gagccttgcctgcgcggtcagggacaggccggcgccgatattatccatctgacggattac
gtggtggaaaaaggcagcgacaagcatatcgcttacgccgccagcaaggcggcgctggat
aacatgacccgttcgttcgcccgcaagctggcgccggaagtgaaggtcaacgccattgcg
ccggcgctgattatctttaaccccggcgacgatgaagcctatcgccagcaggcgctgcaa
aagtcgctgatgaaagtcgcccccggcgaaagcgaagtggtcgaactggtgcactacctg
ctcggcagccgctatgtgaccggccgcacccacggcgtcgacggcggccgtccgctgcgc
tga

DBGET integrated database retrieval system