KEGG   Serratia marcescens FGI94: D781_2257Help
Entry
D781_2257         CDS       T02433                                 

Definition
family 4 glycosyl hydrolase, alpha-galactosidase/6-phospho-beta-glucosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
smaf  Serratia marcescens FGI94
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:smaf00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:smaf00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:smaf00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2388863..2390224
Genome map
AA seq 453 aa AA seqDB search
MATKIVLVGAGSAQFGFGTLGDIFQSKTLYGSEIVLHDINPTSLAVTEKTARDFLAAQDL
PFSISATTDRKTALQGAEFVIISIEVGDRFALWDQDWQIPQQYGIQQVYGENGGPGGLFH
SLRIIPPILAICADVADICPDAWVFNYSNPMSRICTTVQRKFPELNFVGMCHEIASLERY
LPEMLGTPFSNLQLRAAGLNHFSVLLEASYKDSGRDAYPDVRVKAPGYFERLPGYSDILA
YTRQHGKLVETEGSTERDALGGKDSLYPWADRTLFKEVLEKFHHLPITGDSHFGEYIRWA
YEVSDHRGILDFYTFYRNYLGHVEPRIELKLKERVVPIMEGMLTDAGYEEAAVNIPNRGF
IKQLPEFIAVEVPAIVDKKGIHGIKVEMPAGIGGLLSNQIAVHDLTAEAVINGSRDLVIQ
ALLVDSVNDKCRAIPELVDLMIARQSPWLDYLK
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggcgacaaaaatcgtattggtgggcgcgggcagcgcacagttcggcttcggcaccctg
ggggatatcttccagagcaagacgctgtacggcagtgagattgtgctgcacgacattaac
cccacctcactggcggtaacggaaaaaaccgcgcgcgacttcctggcggcgcaggatctg
ccgttcagcatcagcgccaccactgaccgtaaaaccgcgctgcagggcgccgagttcgtg
attatctccatcgaggtcggcgaccgctttgccctgtgggatcaggactggcagatcccg
cagcagtacggcatccagcaggtttacggcgaaaacggcggcccgggcgggctgttccac
tcgctgcgcatcatcccgccgattctggctatctgcgccgatgtcgccgatatctgcccg
gacgcctgggtgttcaactactccaacccgatgagccgtatctgcaccacggtgcagcgc
aagttccccgagctgaactttgtcggcatgtgccacgaaatcgcctcgttggagcgttat
ctgccggaaatgctcggcacgccgttcagcaacctgcagctgcgcgccgccggtctgaac
cacttcagcgtcctgctggaggccagctataaagacagcggccgcgacgcctatccggac
gtgcgcgtcaaggcgccgggctatttcgagcgtctgccgggctacagcgatattctcgcc
tacacccgccagcacggcaaactggtggagacggagggcagcaccgaacgcgacgcgctc
ggcggcaaagacagcctctatccgtgggcggaccgcacgctgttcaaagaggtgctggag
aagttccaccacctgccgatcaccggcgacagccacttcggcgagtatatccgctgggcc
tacgaggtgagcgaccaccgcggcattctcgatttctacaccttctaccgcaactacctc
ggccacgttgagccgcgcatcgagctgaagctgaaagagcgcgtggtgccgattatggaa
ggcatgctgaccgacgccggctatgaagaggcggcggtgaatattcccaaccgcggcttt
atcaaacagctgccggagtttatcgcggtggaagtgccggcgattgtcgataagaagggc
attcacggcatcaaggtggagatgccggccggcatcggcgggctgctcagcaaccagatt
gcggtgcacgacctgaccgccgaggcggtgatcaacggctcgcgcgatctggtgatccag
gcgctgctggtggactcggtgaacgacaagtgccgcgccattccggagctggtggatctg
atgatcgcccgccagagcccgtggctggactatctgaaataa

DBGET integrated database retrieval system