KEGG   Serratia marcescens FGI94: D781_2257Help
Entry
D781_2257         CDS       T02433                                 

Definition
family 4 glycosyl hydrolase, alpha-galactosidase/6-phospho-beta-glucosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
smaf  Serratia marcescens FGI94
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    D781_2257
  Lipid metabolism
   00561 Glycerolipid metabolism
    D781_2257
   00600 Sphingolipid metabolism
    D781_2257
Enzymes [BR:smaf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     D781_2257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2388863..2390224
Genome map
AA seq 453 aa AA seqDB search
MATKIVLVGAGSAQFGFGTLGDIFQSKTLYGSEIVLHDINPTSLAVTEKTARDFLAAQDL
PFSISATTDRKTALQGAEFVIISIEVGDRFALWDQDWQIPQQYGIQQVYGENGGPGGLFH
SLRIIPPILAICADVADICPDAWVFNYSNPMSRICTTVQRKFPELNFVGMCHEIASLERY
LPEMLGTPFSNLQLRAAGLNHFSVLLEASYKDSGRDAYPDVRVKAPGYFERLPGYSDILA
YTRQHGKLVETEGSTERDALGGKDSLYPWADRTLFKEVLEKFHHLPITGDSHFGEYIRWA
YEVSDHRGILDFYTFYRNYLGHVEPRIELKLKERVVPIMEGMLTDAGYEEAAVNIPNRGF
IKQLPEFIAVEVPAIVDKKGIHGIKVEMPAGIGGLLSNQIAVHDLTAEAVINGSRDLVIQ
ALLVDSVNDKCRAIPELVDLMIARQSPWLDYLK
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggcgacaaaaatcgtattggtgggcgcgggcagcgcacagttcggcttcggcaccctg
ggggatatcttccagagcaagacgctgtacggcagtgagattgtgctgcacgacattaac
cccacctcactggcggtaacggaaaaaaccgcgcgcgacttcctggcggcgcaggatctg
ccgttcagcatcagcgccaccactgaccgtaaaaccgcgctgcagggcgccgagttcgtg
attatctccatcgaggtcggcgaccgctttgccctgtgggatcaggactggcagatcccg
cagcagtacggcatccagcaggtttacggcgaaaacggcggcccgggcgggctgttccac
tcgctgcgcatcatcccgccgattctggctatctgcgccgatgtcgccgatatctgcccg
gacgcctgggtgttcaactactccaacccgatgagccgtatctgcaccacggtgcagcgc
aagttccccgagctgaactttgtcggcatgtgccacgaaatcgcctcgttggagcgttat
ctgccggaaatgctcggcacgccgttcagcaacctgcagctgcgcgccgccggtctgaac
cacttcagcgtcctgctggaggccagctataaagacagcggccgcgacgcctatccggac
gtgcgcgtcaaggcgccgggctatttcgagcgtctgccgggctacagcgatattctcgcc
tacacccgccagcacggcaaactggtggagacggagggcagcaccgaacgcgacgcgctc
ggcggcaaagacagcctctatccgtgggcggaccgcacgctgttcaaagaggtgctggag
aagttccaccacctgccgatcaccggcgacagccacttcggcgagtatatccgctgggcc
tacgaggtgagcgaccaccgcggcattctcgatttctacaccttctaccgcaactacctc
ggccacgttgagccgcgcatcgagctgaagctgaaagagcgcgtggtgccgattatggaa
ggcatgctgaccgacgccggctatgaagaggcggcggtgaatattcccaaccgcggcttt
atcaaacagctgccggagtttatcgcggtggaagtgccggcgattgtcgataagaagggc
attcacggcatcaaggtggagatgccggccggcatcggcgggctgctcagcaaccagatt
gcggtgcacgacctgaccgccgaggcggtgatcaacggctcgcgcgatctggtgatccag
gcgctgctggtggactcggtgaacgacaagtgccgcgccattccggagctggtggatctg
atgatcgcccgccagagcccgtggctggactatctgaaataa

DBGET integrated database retrieval system